SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300024572|ref|YP_003757183.1| from Hyphomicrobium denitrificans ATCC 51888

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300024572|ref|YP_003757183.1|
Domain Number 1 Region: 92-274
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.9e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 19-91
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 1.31e-16
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300024572|ref|YP_003757183.1|
Sequence length 296
Comment chemotaxis protein CheR [Hyphomicrobium denitrificans ATCC 51888]
Sequence
MTLAVQRAPARAADAPLVTGEFAFAAADFRAIAEIAKAEAGIDLPESKATLVYSRLAKRL
RSLGLPNFTEYLDRVHGDEQERGNMIAALTTNVTRFFREPHHFEYLKKNILEPRAAHIRK
GGRLRLWSSACSTGQEPYSMALTVLSVFPDARQLDIRILATDLNPNVVAHGKRGLYRNEE
VAEVPQALRTKWLEPVAGDADSMRVGEAARALVAFRELNLMGNWPFKGPFDAIFCRNVAI
YFDHETQGKIWKRLAGLLADGGDLYIGHSERVSGSAMNILTANGVTSYRKKSDAQR
Download sequence
Identical sequences D8JVY3
gi|300024572|ref|YP_003757183.1| WP_013217021.1.30340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]