SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019009|ref|NP_830640.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019009|ref|NP_830640.1|
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000013
Family Tetracyclin repressor-like, N-terminal domain 0.0058
Further Details:      
 
Domain Number 2 Region: 77-171
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000225
Family Tetracyclin repressor-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30019009|ref|NP_830640.1|
Sequence length 192
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MMNKKEKIVYAAIEVFQEKGVEKTKISDIVKLAGIAQGTFYLYFPSKLSVMPAIAEVMVE
KMILAVKEKVQKDVPFSNKVAQVIDAVFHFIEEYREIQALMYAGLASTEHIKEWEAVYEP
LYMWLSEFLSEAKEAGEIRDSVHAERTAKLFIALVESAAEQVYLYDHKDDEQVDLQKAEV
LDFLTHALHIKK
Download sequence
Identical sequences A0A0D0RCN1 A0A0D0RE87 A0A0T8I0E7 A0A162SKS4 A0A1M6P7M4 A0A1Q9KML5 A0A1Y0TRP9 A0A229MCQ0 A0A243DV00 A0A243F6W7 A0A243KJB7 C2SWT8 C2U9T1 J8HY35 J8LQV8 J8N114 Q81HG0
gi|30019009|ref|NP_830640.1| 226900.BC0854 gi|296501569|ref|YP_003663269.1| NP_830640.1.86172 WP_002025356.1.100912 WP_002025356.1.1354 WP_002025356.1.14006 WP_002025356.1.14174 WP_002025356.1.14176 WP_002025356.1.17374 WP_002025356.1.17797 WP_002025356.1.19438 WP_002025356.1.20208 WP_002025356.1.20651 WP_002025356.1.22699 WP_002025356.1.25599 WP_002025356.1.26513 WP_002025356.1.26637 WP_002025356.1.28237 WP_002025356.1.32784 WP_002025356.1.32927 WP_002025356.1.33201 WP_002025356.1.33717 WP_002025356.1.34125 WP_002025356.1.38345 WP_002025356.1.41090 WP_002025356.1.41464 WP_002025356.1.41518 WP_002025356.1.44956 WP_002025356.1.46326 WP_002025356.1.4964 WP_002025356.1.5025 WP_002025356.1.51072 WP_002025356.1.54240 WP_002025356.1.54547 WP_002025356.1.54736 WP_002025356.1.55116 WP_002025356.1.56320 WP_002025356.1.58822 WP_002025356.1.59058 WP_002025356.1.6304 WP_002025356.1.64282 WP_002025356.1.64568 WP_002025356.1.65803 WP_002025356.1.67001 WP_002025356.1.67912 WP_002025356.1.6846 WP_002025356.1.68562 WP_002025356.1.71114 WP_002025356.1.73396 WP_002025356.1.73790 WP_002025356.1.76155 WP_002025356.1.76902 WP_002025356.1.80126 WP_002025356.1.85592 WP_002025356.1.86637 WP_002025356.1.87768 WP_002025356.1.88154 WP_002025356.1.88200 WP_002025356.1.90352 WP_002025356.1.93683 WP_002025356.1.93838 WP_002025356.1.9533 WP_002025356.1.96437 WP_002025356.1.97262 WP_002025356.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]