SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019135|ref|NP_830766.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019135|ref|NP_830766.1|
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000667
Family Tetracyclin repressor-like, N-terminal domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|30019135|ref|NP_830766.1|
Domain Number - Region: 72-149
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000578
Family Tetracyclin repressor-like, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|30019135|ref|NP_830766.1|
Sequence length 188
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MTSSIISKKIIANSLKYLMETESFHKISVSDIMLHCQMRRQTFYYHFKDKFELLSWIYRE
ETKENIIDFLDYETWENIFDLLFDYFYENQKFYRNAFKVIEQNSFNHYLFEHTKNLYMKI
IDELSVSCGFSLSDETKNTIASFYSHGFVGTIKDWIESKCEVDPSIMSSLMKNMINNQLL
LLLEQSAK
Download sequence
Identical sequences A0A0B5ZY66 A0A0E1MLD4 A0A0F5RI99 A0A0G4D5K8 A0A0J1I325 A0A0M0MJZ7 A0A0T8DZG0 A0A154B1A8 A0A1H4HFR2 A0A1K0A154 A0A1M6GPG5 A0A1Q9KM93 A0A1V6LKM1 A0A1W2GUF9 A0A226QV46 A0A229M2X0 A0A242WVZ2 A0A243AM45 A0A243BH77 A0A243BXM3 A0A243DLX6 A0A243EL10 A0A243KLI6 A0A243KQ01 A0A243KU86 A0A243LD27 A0A243MS40 A0A2B4EST8 A0A2B7C7X5 B9ISB1 D8H470 F0PMD4 J8GWS2 J8HZL4 J8JGN6 J8KF30 J8LHD5 Q63F39 Q6HMJ3 Q81H45 R8DPJ0 R8FK75 R8FX17 R8GMW5 R8GXA5 R8KI13 R8M3L7 R8PIH0
gi|52144355|ref|YP_082473.1| NP_830766.1.86172 WP_000204220.1.100241 WP_000204220.1.100621 WP_000204220.1.100771 WP_000204220.1.100912 WP_000204220.1.101931 WP_000204220.1.10762 WP_000204220.1.11387 WP_000204220.1.12289 WP_000204220.1.12751 WP_000204220.1.13024 WP_000204220.1.13221 WP_000204220.1.13279 WP_000204220.1.13498 WP_000204220.1.1354 WP_000204220.1.13975 WP_000204220.1.14006 WP_000204220.1.14084 WP_000204220.1.14174 WP_000204220.1.14176 WP_000204220.1.14882 WP_000204220.1.15163 WP_000204220.1.16013 WP_000204220.1.17265 WP_000204220.1.17408 WP_000204220.1.17424 WP_000204220.1.17927 WP_000204220.1.1809 WP_000204220.1.1907 WP_000204220.1.19438 WP_000204220.1.195 WP_000204220.1.20208 WP_000204220.1.20651 WP_000204220.1.20665 WP_000204220.1.20687 WP_000204220.1.20865 WP_000204220.1.20973 WP_000204220.1.21055 WP_000204220.1.21172 WP_000204220.1.22152 WP_000204220.1.226 WP_000204220.1.22699 WP_000204220.1.23873 WP_000204220.1.2407 WP_000204220.1.24182 WP_000204220.1.24184 WP_000204220.1.24338 WP_000204220.1.24676 WP_000204220.1.24792 WP_000204220.1.24969 WP_000204220.1.24992 WP_000204220.1.2521 WP_000204220.1.25290 WP_000204220.1.25316 WP_000204220.1.25572 WP_000204220.1.25599 WP_000204220.1.2569 WP_000204220.1.26000 WP_000204220.1.26450 WP_000204220.1.26513 WP_000204220.1.26637 WP_000204220.1.26826 WP_000204220.1.28237 WP_000204220.1.28913 WP_000204220.1.29209 WP_000204220.1.29451 WP_000204220.1.29766 WP_000204220.1.29804 WP_000204220.1.30144 WP_000204220.1.3026 WP_000204220.1.30336 WP_000204220.1.31387 WP_000204220.1.31503 WP_000204220.1.3196 WP_000204220.1.32784 WP_000204220.1.32927 WP_000204220.1.33045 WP_000204220.1.3318 WP_000204220.1.33201 WP_000204220.1.33536 WP_000204220.1.33717 WP_000204220.1.33828 WP_000204220.1.34158 WP_000204220.1.35026 WP_000204220.1.35255 WP_000204220.1.35518 WP_000204220.1.3561 WP_000204220.1.3612 WP_000204220.1.3615 WP_000204220.1.3699 WP_000204220.1.37093 WP_000204220.1.37661 WP_000204220.1.37990 WP_000204220.1.38345 WP_000204220.1.4039 WP_000204220.1.40430 WP_000204220.1.41083 WP_000204220.1.41090 WP_000204220.1.41464 WP_000204220.1.41518 WP_000204220.1.42182 WP_000204220.1.42941 WP_000204220.1.43104 WP_000204220.1.43434 WP_000204220.1.44463 WP_000204220.1.44483 WP_000204220.1.4453 WP_000204220.1.44956 WP_000204220.1.45385 WP_000204220.1.45919 WP_000204220.1.46326 WP_000204220.1.46476 WP_000204220.1.4649 WP_000204220.1.46586 WP_000204220.1.474 WP_000204220.1.47441 WP_000204220.1.47936 WP_000204220.1.4865 WP_000204220.1.49428 WP_000204220.1.4964 WP_000204220.1.49831 WP_000204220.1.499 WP_000204220.1.5025 WP_000204220.1.50316 WP_000204220.1.50350 WP_000204220.1.50416 WP_000204220.1.50514 WP_000204220.1.51099 WP_000204220.1.51167 WP_000204220.1.51335 WP_000204220.1.51681 WP_000204220.1.52494 WP_000204220.1.52532 WP_000204220.1.53621 WP_000204220.1.54116 WP_000204220.1.54240 WP_000204220.1.54419 WP_000204220.1.54547 WP_000204220.1.54736 WP_000204220.1.54775 WP_000204220.1.54782 WP_000204220.1.55116 WP_000204220.1.55893 WP_000204220.1.56055 WP_000204220.1.56320 WP_000204220.1.57203 WP_000204220.1.57815 WP_000204220.1.57859 WP_000204220.1.5841 WP_000204220.1.58814 WP_000204220.1.58822 WP_000204220.1.59058 WP_000204220.1.59075 WP_000204220.1.59997 WP_000204220.1.60153 WP_000204220.1.60255 WP_000204220.1.60274 WP_000204220.1.61481 WP_000204220.1.62107 WP_000204220.1.62300 WP_000204220.1.6304 WP_000204220.1.63137 WP_000204220.1.6340 WP_000204220.1.64282 WP_000204220.1.64377 WP_000204220.1.64566 WP_000204220.1.64568 WP_000204220.1.64770 WP_000204220.1.65803 WP_000204220.1.66331 WP_000204220.1.66357 WP_000204220.1.66535 WP_000204220.1.67001 WP_000204220.1.67108 WP_000204220.1.67283 WP_000204220.1.67912 WP_000204220.1.6846 WP_000204220.1.68550 WP_000204220.1.69323 WP_000204220.1.69970 WP_000204220.1.70209 WP_000204220.1.70645 WP_000204220.1.71114 WP_000204220.1.71441 WP_000204220.1.71895 WP_000204220.1.72554 WP_000204220.1.7398 WP_000204220.1.74651 WP_000204220.1.75358 WP_000204220.1.75374 WP_000204220.1.75554 WP_000204220.1.75891 WP_000204220.1.76155 WP_000204220.1.7628 WP_000204220.1.76902 WP_000204220.1.77690 WP_000204220.1.77968 WP_000204220.1.782 WP_000204220.1.7856 WP_000204220.1.79549 WP_000204220.1.80964 WP_000204220.1.81088 WP_000204220.1.81198 WP_000204220.1.82421 WP_000204220.1.82533 WP_000204220.1.84323 WP_000204220.1.84337 WP_000204220.1.84422 WP_000204220.1.84614 WP_000204220.1.85592 WP_000204220.1.85667 WP_000204220.1.86041 WP_000204220.1.86637 WP_000204220.1.87768 WP_000204220.1.87777 WP_000204220.1.87873 WP_000204220.1.88154 WP_000204220.1.88200 WP_000204220.1.88431 WP_000204220.1.8907 WP_000204220.1.89675 WP_000204220.1.90187 WP_000204220.1.91569 WP_000204220.1.91615 WP_000204220.1.9269 WP_000204220.1.93290 WP_000204220.1.93683 WP_000204220.1.93838 WP_000204220.1.93904 WP_000204220.1.93932 WP_000204220.1.94270 WP_000204220.1.94914 WP_000204220.1.95308 WP_000204220.1.9533 WP_000204220.1.95457 WP_000204220.1.95484 WP_000204220.1.95786 WP_000204220.1.96437 WP_000204220.1.97149 WP_000204220.1.97262 WP_000204220.1.97327 WP_000204220.1.98053 WP_000204220.1.98557 WP_000204220.1.98571 WP_000204220.1.98604 WP_000204220.1.99212 WP_000204220.1.99454 YP_035228.1.62562 gi|384178922|ref|YP_005564684.1| gi|30019135|ref|NP_830766.1| gi|222094705|ref|YP_002528765.1| gi|301052612|ref|YP_003790823.1| 226900.BC0980 281309.BT9727_0888 288681.BCZK0869 361100.BCQ_1043 gi|296501697|ref|YP_003663397.1| gi|557623078|ref|YP_008784210.1| gi|49477031|ref|YP_035228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]