SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019208|ref|NP_830839.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019208|ref|NP_830839.1|
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Homeodomain-like 1.8e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 94-191
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000169
Family Tetracyclin repressor-like, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30019208|ref|NP_830839.1|
Sequence length 193
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MTKNLQTSQNIVEASFKLMAEHGIEKMSLSMIAKEVGISKPAIYYHFSSKEALVDFLFEE
IFSDYHFTKYFNEERYTKENFAEKLIADGLHMLSEYEGQEGILRVINEFIVTASRNEKYQ
KRLFEIQEDFLHGFHDLLKKGARLGVVSQHETEENAHTLALVIDNMSNYMLMGFHLKYKE
IWIRNVKNVMKEE
Download sequence
Identical sequences A0A1Q9KM86 A0A1S9YTK2 A0A243K7S3 A0A243LFW4 J8LVL8 J8MX62 J8NWZ2 Q81GX6
226900.BC1053 NP_830839.1.86172 WP_000164837.1.1354 WP_000164837.1.14006 WP_000164837.1.21055 WP_000164837.1.22699 WP_000164837.1.25290 WP_000164837.1.26637 WP_000164837.1.28237 WP_000164837.1.32784 WP_000164837.1.33717 WP_000164837.1.38345 WP_000164837.1.44956 WP_000164837.1.46326 WP_000164837.1.4964 WP_000164837.1.5025 WP_000164837.1.54240 WP_000164837.1.58822 WP_000164837.1.59058 WP_000164837.1.59997 WP_000164837.1.64282 WP_000164837.1.73790 WP_000164837.1.80649 WP_000164837.1.88154 WP_000164837.1.97262 WP_000164837.1.97842 WP_000164837.1.99212 gi|30019208|ref|NP_830839.1| APC24655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]