SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019214|ref|NP_830845.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019214|ref|NP_830845.1|
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000144
Family Tetracyclin repressor-like, N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 87-173
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000934
Family Tetracyclin repressor-like, C-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30019214|ref|NP_830845.1|
Sequence length 178
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MSISITRQKILAAASQIVQCKGVAKLTLEAVAKEAGVSKGGLLYHFSNKEALIEGMIVRG
VEDYEGAIYNKVAEDSERKGRWVRSFVEERLNNERRTEELSSSMMAAFMLKPELLEPLQQ
SFQQLQKNIENDEIDAVCATIIRLAADGLWYSEYLGVGRLSPELREKVIQALIRNSYK
Download sequence
Identical sequences A0A2A8PAB3 J8LS04 Q81GX2
gi|30019214|ref|NP_830845.1| 226900.BC1059 NP_830845.1.86172 WP_000028020.1.22699 WP_000028020.1.26637 WP_000028020.1.46326 WP_000028020.1.58822 WP_000028020.1.73790 WP_000028020.1.80649 WP_000028020.1.97262 WP_000028020.1.97842 APC25750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]