SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019232|ref|NP_830863.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019232|ref|NP_830863.1|
Domain Number 1 Region: 4-78
Classification Level Classification E-value
Superfamily Homeodomain-like 2.77e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 76-189
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000046
Family Tetracyclin repressor-like, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30019232|ref|NP_830863.1|
Sequence length 190
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLI
TEMKQVAESAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQV
DVEIVSVIQSYLKIAIEKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELF
ELYLLKGLSN
Download sequence
Identical sequences A0A023P1P6 A0A0D0PM66 A0A0D0QLZ6 A0A0D1QRV2 A0A0F6FS04 A0A0G3E0X4 A0A0G4D5D3 A0A0G8DY67 A0A0Q9FK95 A0A0Q9GLD6 A0A0T8HGZ7 A0A0W7YGJ2 A0A135WBN8 A0A160L774 A0A193CPL3 A0A1C9BPP7 A0A1I3ZBX5 A0A1M6GV37 A0A1M7BM07 A0A1W2GUC9 A0A229M4C1 A0A242Y7R9 A0A242YZP1 A0A243A6X0 A0A243BBT7 A0A243CAB1 A0A243D699 A0A243DM90 A0A243EXX3 A0A243HI84 A0A243IR20 A0A243JBC3 A0A243K7F0 A0A243L4D4 A0A243L9Y9 A0A243MD44 A0A2A2PB47 A0A2A8ELY7 A0A2A9I1C5 A0A2C9YYQ8 A0A2C9ZFY6 A0A2H3QBS9 B7HGG8 B7IL38 C2NVG0 C2SXF5 C2X8C0 C3DGC1 C3E026 G9Q9Z3 J3UPD2 J7W086 J8CB98 J8I3H0 J8KRE4 J8LTH1 J8MEZ0 J8NW58 J8RJ28 J8Y532 N1LSJ6 Q81GV8 R8C5H6 R8DQD0 R8FMF0 R8FUN0 R8GLX7 R8HB03 R8IF44 R8KGP0 R8N3I4 R8QJ33 R8SH29 R8UFR5 R8YBW2 S3IDL1
gi|296501787|ref|YP_003663487.1| gi|402561870|ref|YP_006604594.1| NP_830863.1.86172 WP_000963381.1.100082 WP_000963381.1.100497 WP_000963381.1.10055 WP_000963381.1.100912 WP_000963381.1.101838 WP_000963381.1.10584 WP_000963381.1.10688 WP_000963381.1.10745 WP_000963381.1.10845 WP_000963381.1.1112 WP_000963381.1.11442 WP_000963381.1.11521 WP_000963381.1.11584 WP_000963381.1.12553 WP_000963381.1.12935 WP_000963381.1.13269 WP_000963381.1.13279 WP_000963381.1.13498 WP_000963381.1.1354 WP_000963381.1.13975 WP_000963381.1.14006 WP_000963381.1.14039 WP_000963381.1.14174 WP_000963381.1.14176 WP_000963381.1.17374 WP_000963381.1.17797 WP_000963381.1.18749 WP_000963381.1.18914 WP_000963381.1.19438 WP_000963381.1.19516 WP_000963381.1.20208 WP_000963381.1.20651 WP_000963381.1.21055 WP_000963381.1.21226 WP_000963381.1.2206 WP_000963381.1.22084 WP_000963381.1.22152 WP_000963381.1.2251 WP_000963381.1.22699 WP_000963381.1.23181 WP_000963381.1.23245 WP_000963381.1.23297 WP_000963381.1.23307 WP_000963381.1.23540 WP_000963381.1.23652 WP_000963381.1.24680 WP_000963381.1.24795 WP_000963381.1.25290 WP_000963381.1.25599 WP_000963381.1.26459 WP_000963381.1.26483 WP_000963381.1.26513 WP_000963381.1.26637 WP_000963381.1.26826 WP_000963381.1.26872 WP_000963381.1.26965 WP_000963381.1.27106 WP_000963381.1.27446 WP_000963381.1.27931 WP_000963381.1.28237 WP_000963381.1.28599 WP_000963381.1.29836 WP_000963381.1.29993 WP_000963381.1.3180 WP_000963381.1.32784 WP_000963381.1.32927 WP_000963381.1.33201 WP_000963381.1.33717 WP_000963381.1.34061 WP_000963381.1.34125 WP_000963381.1.34175 WP_000963381.1.34537 WP_000963381.1.34587 WP_000963381.1.3546 WP_000963381.1.35769 WP_000963381.1.36221 WP_000963381.1.36279 WP_000963381.1.37239 WP_000963381.1.3798 WP_000963381.1.38325 WP_000963381.1.38345 WP_000963381.1.38427 WP_000963381.1.38591 WP_000963381.1.3925 WP_000963381.1.39957 WP_000963381.1.40430 WP_000963381.1.40818 WP_000963381.1.41090 WP_000963381.1.41464 WP_000963381.1.41518 WP_000963381.1.4185 WP_000963381.1.41879 WP_000963381.1.42167 WP_000963381.1.42218 WP_000963381.1.42485 WP_000963381.1.43442 WP_000963381.1.4355 WP_000963381.1.43767 WP_000963381.1.43914 WP_000963381.1.44348 WP_000963381.1.44497 WP_000963381.1.44956 WP_000963381.1.45317 WP_000963381.1.45720 WP_000963381.1.46326 WP_000963381.1.47975 WP_000963381.1.48759 WP_000963381.1.49455 WP_000963381.1.4964 WP_000963381.1.49702 WP_000963381.1.50042 WP_000963381.1.50694 WP_000963381.1.51047 WP_000963381.1.51072 WP_000963381.1.52284 WP_000963381.1.54142 WP_000963381.1.54240 WP_000963381.1.54736 WP_000963381.1.54777 WP_000963381.1.55077 WP_000963381.1.55116 WP_000963381.1.5543 WP_000963381.1.56320 WP_000963381.1.57732 WP_000963381.1.58586 WP_000963381.1.58632 WP_000963381.1.58712 WP_000963381.1.58822 WP_000963381.1.59058 WP_000963381.1.59384 WP_000963381.1.59997 WP_000963381.1.60153 WP_000963381.1.60255 WP_000963381.1.60334 WP_000963381.1.60526 WP_000963381.1.61799 WP_000963381.1.6241 WP_000963381.1.6304 WP_000963381.1.63743 WP_000963381.1.63789 WP_000963381.1.63902 WP_000963381.1.64282 WP_000963381.1.64421 WP_000963381.1.64568 WP_000963381.1.64764 WP_000963381.1.65803 WP_000963381.1.66999 WP_000963381.1.67001 WP_000963381.1.674 WP_000963381.1.6743 WP_000963381.1.67873 WP_000963381.1.67912 WP_000963381.1.68007 WP_000963381.1.68346 WP_000963381.1.6846 WP_000963381.1.68562 WP_000963381.1.69347 WP_000963381.1.69501 WP_000963381.1.70108 WP_000963381.1.70181 WP_000963381.1.70667 WP_000963381.1.71114 WP_000963381.1.72752 WP_000963381.1.73396 WP_000963381.1.73457 WP_000963381.1.73594 WP_000963381.1.73638 WP_000963381.1.73790 WP_000963381.1.74302 WP_000963381.1.74372 WP_000963381.1.74651 WP_000963381.1.74832 WP_000963381.1.74857 WP_000963381.1.74863 WP_000963381.1.74976 WP_000963381.1.7534 WP_000963381.1.75866 WP_000963381.1.75891 WP_000963381.1.7593 WP_000963381.1.75942 WP_000963381.1.76086 WP_000963381.1.76155 WP_000963381.1.76804 WP_000963381.1.76883 WP_000963381.1.76902 WP_000963381.1.77386 WP_000963381.1.77402 WP_000963381.1.79549 WP_000963381.1.80126 WP_000963381.1.80649 WP_000963381.1.81000 WP_000963381.1.81773 WP_000963381.1.83666 WP_000963381.1.83694 WP_000963381.1.83977 WP_000963381.1.84614 WP_000963381.1.84775 WP_000963381.1.85348 WP_000963381.1.85592 WP_000963381.1.85667 WP_000963381.1.85928 WP_000963381.1.86374 WP_000963381.1.86619 WP_000963381.1.86637 WP_000963381.1.86763 WP_000963381.1.869 WP_000963381.1.87013 WP_000963381.1.87705 WP_000963381.1.87725 WP_000963381.1.87768 WP_000963381.1.87777 WP_000963381.1.87947 WP_000963381.1.88154 WP_000963381.1.88200 WP_000963381.1.88269 WP_000963381.1.89009 WP_000963381.1.89145 WP_000963381.1.89718 WP_000963381.1.90352 WP_000963381.1.90452 WP_000963381.1.90466 WP_000963381.1.90665 WP_000963381.1.91367 WP_000963381.1.92555 WP_000963381.1.93683 WP_000963381.1.94914 WP_000963381.1.95576 WP_000963381.1.9623 WP_000963381.1.96272 WP_000963381.1.96287 WP_000963381.1.96437 WP_000963381.1.9700 WP_000963381.1.9703 WP_000963381.1.97082 WP_000963381.1.97262 WP_000963381.1.97561 WP_000963381.1.97670 WP_000963381.1.97816 WP_000963381.1.97821 WP_000963381.1.97830 WP_000963381.1.97842 WP_000963381.1.98315 WP_000963381.1.9860 WP_000963381.1.98604 WP_000963381.1.99212 WP_000963381.1.99636 gi|218896131|ref|YP_002444542.1| gi|449087889|ref|YP_007420330.1| gi|434374126|ref|YP_006608770.1| gi|30019232|ref|NP_830863.1| gi|218232519|ref|YP_002365845.1| 226900.BC1077 405531.BCG9842_B4194 405532.BCB4264_A1112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]