SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019956|ref|NP_831587.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019956|ref|NP_831587.1|
Domain Number 1 Region: 13-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000399
Family Tetracyclin repressor-like, N-terminal domain 0.024
Further Details:      
 
Weak hits

Sequence:  gi|30019956|ref|NP_831587.1|
Domain Number - Region: 112-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.014
Family Tetracyclin repressor-like, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30019956|ref|NP_831587.1|
Sequence length 194
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MKKDLSALKEARFNAILDSATILLVENPTASMNEIAEYAGIGIATLHRYVESREKLMLFL
GHRAIQLVSDTVNQIPLDEERSENYIPELIEALIPLGDKIYFLGHDASVFNNKELGEAEE
KLREPLRRVIELLQQRGYFQQTVSSEWILNTLYALLFHTWEQVHEGNVAKKSAAELVLNT
FYYGFKAKDELRGK
Download sequence
Identical sequences A0A0F6JDN8 A0A0G4D2U5 A0A0G8F930 A0A0T8XN90 A0A1B1L435 A0A1C9BS02 A0A1H6CCW0 A0A1Q9KJX8 A0A229MF09 A0A242WNJ1 A0A243EG72 A0A243EJ05 A0A243LI89 A0A2A2P9S7 B7HIS4 J8HLG2 J8K9S4 J8M354 J8MV04 M1QJQ8 N1LIF2 Q81EZ4 R8DR85 R8FQ38 R8FRL6 R8GKC2 R8KDE5
APC22834 gi|30019956|ref|NP_831587.1| 226900.BC1814 405532.BCB4264_A1889 gi|410674123|ref|YP_006926494.1| NP_831587.1.86172 WP_000710981.1.100095 WP_000710981.1.101720 WP_000710981.1.11442 WP_000710981.1.11521 WP_000710981.1.12553 WP_000710981.1.1354 WP_000710981.1.13975 WP_000710981.1.14006 WP_000710981.1.14174 WP_000710981.1.17374 WP_000710981.1.20208 WP_000710981.1.21055 WP_000710981.1.22152 WP_000710981.1.23297 WP_000710981.1.23360 WP_000710981.1.24680 WP_000710981.1.25290 WP_000710981.1.26513 WP_000710981.1.26637 WP_000710981.1.26826 WP_000710981.1.28237 WP_000710981.1.32784 WP_000710981.1.33717 WP_000710981.1.33790 WP_000710981.1.38345 WP_000710981.1.39957 WP_000710981.1.41090 WP_000710981.1.41729 WP_000710981.1.4447 WP_000710981.1.4964 WP_000710981.1.5025 WP_000710981.1.54547 WP_000710981.1.54736 WP_000710981.1.55116 WP_000710981.1.56320 WP_000710981.1.57561 WP_000710981.1.58822 WP_000710981.1.5895 WP_000710981.1.59058 WP_000710981.1.60255 WP_000710981.1.61820 WP_000710981.1.61919 WP_000710981.1.62277 WP_000710981.1.64282 WP_000710981.1.64568 WP_000710981.1.67001 WP_000710981.1.67912 WP_000710981.1.70108 WP_000710981.1.71652 WP_000710981.1.73790 WP_000710981.1.74302 WP_000710981.1.75891 WP_000710981.1.7593 WP_000710981.1.76086 WP_000710981.1.76155 WP_000710981.1.76902 WP_000710981.1.77968 WP_000710981.1.79549 WP_000710981.1.80622 WP_000710981.1.80649 WP_000710981.1.84541 WP_000710981.1.85667 WP_000710981.1.8577 WP_000710981.1.88200 WP_000710981.1.89325 WP_000710981.1.90352 WP_000710981.1.91020 WP_000710981.1.93683 WP_000710981.1.93838 WP_000710981.1.94914 WP_000710981.1.9533 WP_000710981.1.96287 WP_000710981.1.97262 WP_000710981.1.97327 WP_000710981.1.97842 WP_000710981.1.98604 gi|218232596|ref|YP_002366606.1| gi|452198156|ref|YP_007478237.1| gi|384185830|ref|YP_005571726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]