SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30019960|ref|NP_831591.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30019960|ref|NP_831591.1|
Domain Number 1 Region: 77-191
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 5.48e-20
Family Tetracyclin repressor-like, C-terminal domain 0.0075
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000436
Family Tetracyclin repressor-like, N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30019960|ref|NP_831591.1|
Sequence length 196
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MTKVDKIKEKIIETSLYLFNTNGITRTSIQDIMTATELPKGSIYRRFKSKEEIVLAAYDK
SGEIMWSHFHKAMENKKTAIDKILAIFLVYQDAANNPPIAGGCPLLNSAIESTGVFPELQ
KAAAKGYDDTVMLMASLIKEGIEKQELKEDIDIISLASFLASSMEGAIMASRVSNDNIHH
HYFIEQIKHHLFSYSK
Download sequence
Identical sequences A0A0G4D4V9 A0A0T8XNF4 A0A164U2L8 A0A1C9BS14 A0A1M6LIF2 A0A1Q9KJX7 A0A243DXH1 A0A243KLQ1 A0A2A9R0K6 J8I279 J8LHU8 J8NK94 Q81EZ0 R8H7N4
NP_831591.1.86172 WP_000169640.1.11442 WP_000169640.1.1354 WP_000169640.1.13975 WP_000169640.1.14006 WP_000169640.1.14174 WP_000169640.1.14176 WP_000169640.1.19438 WP_000169640.1.22699 WP_000169640.1.25599 WP_000169640.1.26513 WP_000169640.1.26637 WP_000169640.1.32927 WP_000169640.1.33201 WP_000169640.1.33717 WP_000169640.1.38345 WP_000169640.1.41464 WP_000169640.1.41518 WP_000169640.1.44956 WP_000169640.1.46326 WP_000169640.1.4964 WP_000169640.1.5025 WP_000169640.1.54736 WP_000169640.1.58822 WP_000169640.1.59997 WP_000169640.1.60153 WP_000169640.1.6304 WP_000169640.1.64568 WP_000169640.1.65803 WP_000169640.1.6846 WP_000169640.1.68562 WP_000169640.1.70108 WP_000169640.1.71114 WP_000169640.1.73790 WP_000169640.1.76155 WP_000169640.1.76902 WP_000169640.1.85592 WP_000169640.1.86637 WP_000169640.1.87768 WP_000169640.1.88154 WP_000169640.1.93683 WP_000169640.1.96437 WP_000169640.1.97262 WP_000169640.1.98604 gi|30019960|ref|NP_831591.1| 226900.BC1818 gi|296502513|ref|YP_003664213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]