SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30020472|ref|NP_832103.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30020472|ref|NP_832103.1|
Domain Number 1 Region: 13-98
Classification Level Classification E-value
Superfamily Homeodomain-like 2.98e-18
Family Tetracyclin repressor-like, N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 124-206
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000127
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30020472|ref|NP_832103.1|
Sequence length 209
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MYLEQKQRPLGRPRQNKNTKSTKENILEVATRLFLTQNYQVVSMDEVAKVCGVTKATVYY
YYSTKADLFTATMIEMMVRIRENMSQILSTNKTLEERLLDFAKVYLHATMDIDMKNFMKD
AKLSLSEEQLKQLKNAEDNMYEVLEKALDNAMHIGEIPKGNAKFAAHAFVSLLSIGNFKD
ENHNPILANIDELAQEIVSFYWNGLGHSY
Download sequence
Identical sequences A0A229MJQ6 A0A2B9T281 C2T0U4 Q81DL9
gi|30020472|ref|NP_832103.1| 226900.BC2340 APC25893 NP_832103.1.86172 WP_002195490.1.100912 WP_002195490.1.20208 WP_002195490.1.22699 WP_002195490.1.26637 WP_002195490.1.32784 WP_002195490.1.33201 WP_002195490.1.33717 WP_002195490.1.38345 WP_002195490.1.51072 WP_002195490.1.55116 WP_002195490.1.58822 WP_002195490.1.59997 WP_002195490.1.64282 WP_002195490.1.65803 WP_002195490.1.67001 WP_002195490.1.67912 WP_002195490.1.73396 WP_002195490.1.76902 WP_002195490.1.80126 WP_002195490.1.80649 WP_002195490.1.87768 WP_002195490.1.88200 WP_002195490.1.97842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]