SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30020541|ref|NP_832172.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30020541|ref|NP_832172.1|
Domain Number 1 Region: 6-69
Classification Level Classification E-value
Superfamily Homeodomain-like 1.54e-19
Family Tetracyclin repressor-like, N-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 84-195
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000213
Family Tetracyclin repressor-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30020541|ref|NP_832172.1|
Sequence length 211
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MRIVKEYEERRKEILETAERLFLTKGYTKTTVNDILKEIGIAKGTFYHYFKSKEEVMDEI
IMRIIKEDVTKAKRIVSNPDIHVLDKLFKILMEQSPKSGDVKEKMIEQFHQPNNAEMHQK
SLVQSIIHLSPVLTEVLEQGIEEGIFYTPYPQETIELLLSSAQVIFDDGLFQWKPEEMMR
RAKAYIKMMEVSVGAKEGSFDYMIEVLMKQK
Download sequence
Identical sequences A0A0T8G949 A0A164QVC5 A0A1Q9KPF0 A0A1Y0TLX2 A0A243KY74 A0A243LRF6 C2T186 Q81DF7
gi|30020541|ref|NP_832172.1| NP_832172.1.86172 WP_001223578.1.100912 WP_001223578.1.1354 WP_001223578.1.14006 WP_001223578.1.21055 WP_001223578.1.24680 WP_001223578.1.25290 WP_001223578.1.26637 WP_001223578.1.28237 WP_001223578.1.33201 WP_001223578.1.33717 WP_001223578.1.38345 WP_001223578.1.46326 WP_001223578.1.4964 WP_001223578.1.5025 WP_001223578.1.51072 WP_001223578.1.54240 WP_001223578.1.58822 WP_001223578.1.59058 WP_001223578.1.65803 WP_001223578.1.73396 WP_001223578.1.76902 WP_001223578.1.80126 WP_001223578.1.87768 WP_001223578.1.88154 WP_001223578.1.96287 WP_001223578.1.97262 APC25903 226900.BC2410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]