SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30020609|ref|NP_832240.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30020609|ref|NP_832240.1|
Domain Number 1 Region: 15-83
Classification Level Classification E-value
Superfamily Homeodomain-like 3.03e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 102-215
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000356
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30020609|ref|NP_832240.1|
Sequence length 217
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MQKDWLEELIAATNTDKRNERQMRILEAAVDMFGEKGYASTSTSEIAKRAGVAEGTIFRY
YKTKKDLLLAVVMPTLTKFAAPFFVQTFAKEIFKSDYESYEGLLRVVIHNRFKFAQKHFP
MIKILIQEVPFQPELKNEIQQLVETELFSHFKKLIVKFQEEGEIIEIPPSSVLRLTLSAV
LGLLLTRFLLLPEEKWSDEAEIENTIQFILYGLTPRF
Download sequence
Identical sequences A0A0T8MKG4 A0A164ZWV0 A0A1Y0TM12 C2T9S5 Q81D94
226900.BC2480 NP_832240.1.86172 WP_001168185.1.100912 WP_001168185.1.20651 WP_001168185.1.26637 WP_001168185.1.51072 WP_001168185.1.58822 WP_001168185.1.73396 WP_001168185.1.76902 WP_001168185.1.80126 gi|30020609|ref|NP_832240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]