SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30020881|ref|NP_832512.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30020881|ref|NP_832512.1|
Domain Number 1 Region: 90-202
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.53e-27
Family Tetracyclin repressor-like, C-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000821
Family Tetracyclin repressor-like, N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|30020881|ref|NP_832512.1|
Sequence length 203
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MKNSTLSSRKHRSLETKKKLLHSGYTIFINNGFQKTTITQIIKHAETGYGTAYVYFKNKD
DLLISLMEDVMNRFYNIAERSFSPQTKEEARIMIQNQVRAFLQLANEERAILQVVEEAIG
LSREIRQKWDEIRERFITSIKQDITYSQESGLAPPNLNKEIVARGWFSMNESFLWTITQN
DKKINLEEIVYTLTEIYTTGLYK
Download sequence
Identical sequences A0A164VXX9 C2T1Y5 Q81CJ9
NP_832512.1.86172 WP_000798541.1.26637 WP_000798541.1.58822 WP_000798541.1.76902 gi|30020881|ref|NP_832512.1| 226900.BC2760 APC24825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]