SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30021031|ref|NP_832662.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30021031|ref|NP_832662.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000021
Family Tetracyclin repressor-like, N-terminal domain 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|30021031|ref|NP_832662.1|
Domain Number - Region: 110-160
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00125
Family Tetracyclin repressor-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30021031|ref|NP_832662.1|
Sequence length 196
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MKRISKEPDVRRQELMDIGFELYMKNGMKGFGIKDVVNHAGVATGLFYYYFKSKENFVDE
VLNDCIVKNMELIEEILVSNERSVMQKMKDSLDIFWTFIEKLAPYKNVSSFQTEQHFQLE
QKLFARMQPLIRQVIEEGVKTGIFYTDNSLLASGFILYGLNSIAHSEVKLNLDTKHEMVN
LVLTTLRYNQKEGESL
Download sequence
Identical sequences A0A164VFK7 A0A1Y0TML1 A0A229MKZ5 A0A243DVT5 C2T2E5 J8LNJ1 Q81C66 R8H6E6
gi|296503453|ref|YP_003665153.1| 226900.BC2914 NP_832662.1.86172 WP_000822620.1.100912 WP_000822620.1.20208 WP_000822620.1.26637 WP_000822620.1.33201 WP_000822620.1.41518 WP_000822620.1.44956 WP_000822620.1.51072 WP_000822620.1.55116 WP_000822620.1.58822 WP_000822620.1.60153 WP_000822620.1.67001 WP_000822620.1.67912 WP_000822620.1.71114 WP_000822620.1.73396 WP_000822620.1.73790 WP_000822620.1.76902 WP_000822620.1.80126 WP_000822620.1.80649 WP_000822620.1.88200 WP_000822620.1.97842 gi|30021031|ref|NP_832662.1| APC24860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]