SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30021052|ref|NP_832683.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30021052|ref|NP_832683.1|
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily Homeodomain-like 2e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 78-185
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000222
Family Tetracyclin repressor-like, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|30021052|ref|NP_832683.1|
Sequence length 188
Comment transcriptional repressor Bm3R1 [Bacillus cereus ATCC 14579]
Sequence
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFSKSM
LELSEIIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFD
DFIGFFMNIIEDGIAKGFLRPLPPVALIIIVYQPLEKLTKVIATGQLEYSKELVKELEES
SWNAIRII
Download sequence
Identical sequences A0A0J7GZJ3 A0A0K0S9I1 A0A0U0NIL4 A0A135WXR6 A0A242YR09 A0A243I3X2 A0A2C9YS70 B7H634 J7W4M5 N1M184 Q81C47
gi|218236018|ref|YP_002367662.1| NP_832683.1.86172 WP_001107299.1.100082 WP_001107299.1.10584 WP_001107299.1.12553 WP_001107299.1.14039 WP_001107299.1.23652 WP_001107299.1.26637 WP_001107299.1.27931 WP_001107299.1.35694 WP_001107299.1.39957 WP_001107299.1.40034 WP_001107299.1.45317 WP_001107299.1.45720 WP_001107299.1.47975 WP_001107299.1.51681 WP_001107299.1.57732 WP_001107299.1.58822 WP_001107299.1.60334 WP_001107299.1.61243 WP_001107299.1.63902 WP_001107299.1.6816 WP_001107299.1.71242 WP_001107299.1.72484 WP_001107299.1.73457 WP_001107299.1.73594 WP_001107299.1.7593 WP_001107299.1.76086 WP_001107299.1.76804 WP_001107299.1.76902 WP_001107299.1.77567 WP_001107299.1.80649 WP_001107299.1.81570 WP_001107299.1.81773 WP_001107299.1.85348 WP_001107299.1.86374 WP_001107299.1.86619 WP_001107299.1.87947 WP_001107299.1.88269 WP_001107299.1.90254 WP_001107299.1.90352 WP_001107299.1.95576 WP_001107299.1.97082 WP_001107299.1.97670 WP_001107299.1.97842 WP_001107299.1.99212 gi|30021052|ref|NP_832683.1| 226900.BC2936 405532.BCB4264_A2954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]