SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30021270|ref|NP_832901.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30021270|ref|NP_832901.1|
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily Homeodomain-like 5.64e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 82-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000209
Family Tetracyclin repressor-like, C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|30021270|ref|NP_832901.1|
Sequence length 194
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MTKVKLMNQKRVIEVAATLFLEKGFAYTSMDELVRVSKVSKSNVYYHFSNKEVLLEGVVD
YWIEMYQSAIDDVLSQNQFLVEDRIQLFLKQLSQGVQSREYKGSCPFITLYIQSPTQATQ
IKEKIGLFFTGLQKKVSLLLKQGVENGEFRNTINIDEVASLFITNLEGALFISETLKDAT
VITKTADHFFKLLR
Download sequence
Identical sequences C2T9Y8 Q81BJ7
226900.BC3160 NP_832901.1.86172 WP_002196027.1.26637 WP_002196027.1.58822 gi|30021270|ref|NP_832901.1| APC26003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]