SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30021624|ref|NP_833255.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30021624|ref|NP_833255.1|
Domain Number 1 Region: 87-206
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 6.67e-27
Family Tetracyclin repressor-like, C-terminal domain 0.000000456
Further Details:      
 
Domain Number 2 Region: 11-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000113
Family Tetracyclin repressor-like, N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30021624|ref|NP_833255.1|
Sequence length 211
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MKYILFEVCEMGKSREQTMENILKAAKKKFGERGYEGTSIQEIAKEAKVNVAMASYYFNG
KENLYYEVFKKYGLANELPNFLEKNQFDPINALRDYLTVFTTHIKENPEIGSLAYEEIIK
ESARLEKIKPYFIGNFEQLKEILQEGEKQGAFHFFSINHTIHWITSIVLFPKFKKFIDSL
GTNETNDINHEWMPEDLVDRIVTALTDKPKV
Download sequence
Identical sequences Q81AN9
gi|30021624|ref|NP_833255.1| NP_833255.1.86172 APC26049 226900.BC3522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]