SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30021693|ref|NP_833324.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30021693|ref|NP_833324.1|
Domain Number 1 Region: 4-84
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-17
Family Tetracyclin repressor-like, N-terminal domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|30021693|ref|NP_833324.1|
Domain Number - Region: 105-193
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000836
Family Tetracyclin repressor-like, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30021693|ref|NP_833324.1|
Sequence length 197
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MNGFERVKEKKKRAIKEAAFVLFSERGFNEVKIEHIAKEANVSQVTIYNHFGSKDALFRE
LIQEFIISEFQYYKELAEEKLPFHDMMQKMIVRKMNTGGLFQPDMLLQMMQRDEELRKFI
YSYQNEKILPWYLEILEQAQRKNEINPHLTKEMMLLYIQMFTKLGDEFGAQLLEGDREKH
IKDIVTMFFYGLSVPEK
Download sequence
Identical sequences A0A0G4CZM2 A0A0U0JK19 A0A164S6Z5 A0A1Y0TLH8 A0A229M6Z3 A0A243KTA1 J8I0Y1 J8N7V6 Q81AH6
NP_833324.1.86172 WP_001013026.1.100912 WP_001013026.1.1354 WP_001013026.1.14006 WP_001013026.1.14174 WP_001013026.1.20208 WP_001013026.1.20651 WP_001013026.1.21055 WP_001013026.1.24680 WP_001013026.1.26637 WP_001013026.1.33201 WP_001013026.1.41090 WP_001013026.1.4964 WP_001013026.1.51072 WP_001013026.1.54240 WP_001013026.1.55116 WP_001013026.1.56320 WP_001013026.1.58822 WP_001013026.1.59058 WP_001013026.1.59997 WP_001013026.1.64282 WP_001013026.1.65803 WP_001013026.1.67001 WP_001013026.1.67912 WP_001013026.1.73396 WP_001013026.1.76155 WP_001013026.1.76902 WP_001013026.1.80126 WP_001013026.1.80649 WP_001013026.1.87768 WP_001013026.1.88154 WP_001013026.1.88200 WP_001013026.1.93683 WP_001013026.1.97842 WP_001013026.1.98604 gi|30021693|ref|NP_833324.1| 226900.BC3592 APC26057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]