SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30022295|ref|NP_833926.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30022295|ref|NP_833926.1|
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000121
Family Tetracyclin repressor-like, N-terminal domain 0.007
Further Details:      
 
Weak hits

Sequence:  gi|30022295|ref|NP_833926.1|
Domain Number - Region: 80-192
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000237
Family Tetracyclin repressor-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|30022295|ref|NP_833926.1|
Sequence length 193
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MKMTANRIKAVALSHFARYGYEGTSLANIAQEVGIKKPSIYAHFKGKEELYFICLESALQ
KDLQSFTGDIESFSNSSTEELLLKLLKGYAKRFGESEESMFWLRTSYFPPDAFREQIINK
ANVHIENVGKLLFPVFKRASEQDELHNIEVKDALEAFLCLLDGLMVELLYAGLNRFETRL
DASWKVFWRGLSN
Download sequence
Identical sequences A0A023PA14 A0A0D0PN30 A0A0D0PT00 A0A0E8TI81 A0A0F6FK68 A0A0F6JFQ4 A0A0G3E205 A0A0G4CVZ1 A0A0J7FYW3 A0A0W7XZT2 A0A135WUW8 A0A193CXA9 A0A1C9BYP5 A0A1G1USI4 A0A1H5WAJ1 A0A1M7ED00 A0A1Q9KGF4 A0A1V6LMJ1 A0A1W2GH83 A0A243KFR3 A0A243L1S0 A0A243MGC7 A0A2A9HMC8 C2P3H1 C2RD55 C2T5W6 C2UIY0 C2WSN3 C2XGL9 C3E8F2 G9Q1V5 J7YKW7 J8IL43 J8L2T5 J8MKQ1 J8N9P9 J8R0C3 J9CD38 K0FSG3 Q818N7 R8E061 R8E1N2 R8FEG2 R8G1N1 R8GCH3 R8GTY8 R8K247 R8LAX1 R8LLA5 R8PK25 R8TF52 S3IK57 W8YG96
gi|30022295|ref|NP_833926.1| NP_833926.1.86172 WP_002005730.1.1354 WP_002005730.1.40430 WP_002005730.1.47975 WP_002005730.1.6743 WP_002005730.1.76883 WP_002005730.1.84614 WP_002005730.1.86041 APC25068 gi|410676603|ref|YP_006928974.1| 226900.BC4212 gi|407706742|ref|YP_006830327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]