SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30022602|ref|NP_834233.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30022602|ref|NP_834233.1|
Domain Number 1 Region: 78-189
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 7.51e-26
Family Tetracyclin repressor-like, C-terminal domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Homeodomain-like 1.59e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30022602|ref|NP_834233.1|
Sequence length 195
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MKKNRPKYNQIIDAAVIVIAENGYHQAQVSKIAKQAGVADGTIYLYFKNKEDILISLFQE
KMGEFVETIRQKTAGIESAVSKLFMLVETHFLLLSQNDPLAIVTQLELRQSNQDLRLKIN
EVLKGYLQVMDEILETGIKQGEFQADLNVRVARQMIFGTVDEVVTNWVMSDHKYDLVALS
KTVHGLLIAACGYRQ
Download sequence
Identical sequences A0A0D1RAC2 A0A0E1MHP2 A0A0F6FV50 A0A0G4CTY3 A0A0K0SE42 A0A1Q9KFM4 A0A1R1M9H9 A0A226R5J3 A0A229MPC9 A0A229MWC6 A0A242XIK9 A0A242YC33 A0A242ZJL3 A0A242ZQQ1 A0A243BZX1 A0A243CBM4 A0A243DDW8 A0A243DPZ4 A0A243EDX3 A0A243ENW6 A0A243EVK7 A0A243FHH0 A0A243HHE2 A0A246UDG9 A0A2A2P2V1 A0A2A7DC41 A0A2A7ED82 B5UN75 B7HF38 B7HRG8 J8GZA7 M1QF56 N1LQV1 Q817L5 V5MGB5
gi|217962008|ref|YP_002340578.1| APC26148 NP_834233.1.86172 WP_000742223.1.100082 WP_000742223.1.10055 WP_000742223.1.100912 WP_000742223.1.101224 WP_000742223.1.101720 WP_000742223.1.10584 WP_000742223.1.10688 WP_000742223.1.10745 WP_000742223.1.10845 WP_000742223.1.1112 WP_000742223.1.11442 WP_000742223.1.11521 WP_000742223.1.11584 WP_000742223.1.1228 WP_000742223.1.12553 WP_000742223.1.12751 WP_000742223.1.13279 WP_000742223.1.13498 WP_000742223.1.13975 WP_000742223.1.14006 WP_000742223.1.14039 WP_000742223.1.14174 WP_000742223.1.14176 WP_000742223.1.17374 WP_000742223.1.17408 WP_000742223.1.17797 WP_000742223.1.1850 WP_000742223.1.18749 WP_000742223.1.18840 WP_000742223.1.18914 WP_000742223.1.19438 WP_000742223.1.195 WP_000742223.1.19516 WP_000742223.1.20208 WP_000742223.1.20651 WP_000742223.1.20665 WP_000742223.1.20973 WP_000742223.1.2206 WP_000742223.1.22152 WP_000742223.1.2251 WP_000742223.1.226 WP_000742223.1.22699 WP_000742223.1.23110 WP_000742223.1.23181 WP_000742223.1.23245 WP_000742223.1.23297 WP_000742223.1.23307 WP_000742223.1.23360 WP_000742223.1.23540 WP_000742223.1.23652 WP_000742223.1.24182 WP_000742223.1.24377 WP_000742223.1.24680 WP_000742223.1.24795 WP_000742223.1.2521 WP_000742223.1.25290 WP_000742223.1.25599 WP_000742223.1.25757 WP_000742223.1.26483 WP_000742223.1.26499 WP_000742223.1.26513 WP_000742223.1.26637 WP_000742223.1.26826 WP_000742223.1.26872 WP_000742223.1.26965 WP_000742223.1.27106 WP_000742223.1.27334 WP_000742223.1.27931 WP_000742223.1.28237 WP_000742223.1.28913 WP_000742223.1.29836 WP_000742223.1.29993 WP_000742223.1.3026 WP_000742223.1.30317 WP_000742223.1.31221 WP_000742223.1.31503 WP_000742223.1.31685 WP_000742223.1.3180 WP_000742223.1.3249 WP_000742223.1.32522 WP_000742223.1.32784 WP_000742223.1.32927 WP_000742223.1.33061 WP_000742223.1.33201 WP_000742223.1.33717 WP_000742223.1.33790 WP_000742223.1.34061 WP_000742223.1.34125 WP_000742223.1.34175 WP_000742223.1.34587 WP_000742223.1.35153 WP_000742223.1.35518 WP_000742223.1.35694 WP_000742223.1.36221 WP_000742223.1.37239 WP_000742223.1.3798 WP_000742223.1.38345 WP_000742223.1.38427 WP_000742223.1.38517 WP_000742223.1.38591 WP_000742223.1.3925 WP_000742223.1.39411 WP_000742223.1.39957 WP_000742223.1.40034 WP_000742223.1.40818 WP_000742223.1.40839 WP_000742223.1.41090 WP_000742223.1.41464 WP_000742223.1.41518 WP_000742223.1.41729 WP_000742223.1.4185 WP_000742223.1.41879 WP_000742223.1.42165 WP_000742223.1.42167 WP_000742223.1.42218 WP_000742223.1.42485 WP_000742223.1.43434 WP_000742223.1.43442 WP_000742223.1.43762 WP_000742223.1.43767 WP_000742223.1.43914 WP_000742223.1.44348 WP_000742223.1.44428 WP_000742223.1.44497 WP_000742223.1.45317 WP_000742223.1.45720 WP_000742223.1.46326 WP_000742223.1.46524 WP_000742223.1.46746 WP_000742223.1.47000 WP_000742223.1.47097 WP_000742223.1.47437 WP_000742223.1.47936 WP_000742223.1.48164 WP_000742223.1.48311 WP_000742223.1.48599 WP_000742223.1.49455 WP_000742223.1.4964 WP_000742223.1.49702 WP_000742223.1.5025 WP_000742223.1.50694 WP_000742223.1.51047 WP_000742223.1.51072 WP_000742223.1.51087 WP_000742223.1.51335 WP_000742223.1.51681 WP_000742223.1.52494 WP_000742223.1.52756 WP_000742223.1.53621 WP_000742223.1.54116 WP_000742223.1.54142 WP_000742223.1.54240 WP_000742223.1.54547 WP_000742223.1.54736 WP_000742223.1.54777 WP_000742223.1.55057 WP_000742223.1.55077 WP_000742223.1.55116 WP_000742223.1.5543 WP_000742223.1.56320 WP_000742223.1.57561 WP_000742223.1.57732 WP_000742223.1.58586 WP_000742223.1.58632 WP_000742223.1.58822 WP_000742223.1.5895 WP_000742223.1.59058 WP_000742223.1.59773 WP_000742223.1.59997 WP_000742223.1.60153 WP_000742223.1.60255 WP_000742223.1.60334 WP_000742223.1.60781 WP_000742223.1.61243 WP_000742223.1.61820 WP_000742223.1.61919 WP_000742223.1.62107 WP_000742223.1.62277 WP_000742223.1.62770 WP_000742223.1.62918 WP_000742223.1.6304 WP_000742223.1.6340 WP_000742223.1.63743 WP_000742223.1.63789 WP_000742223.1.63902 WP_000742223.1.64282 WP_000742223.1.64568 WP_000742223.1.6475 WP_000742223.1.64764 WP_000742223.1.65803 WP_000742223.1.66932 WP_000742223.1.66999 WP_000742223.1.67001 WP_000742223.1.6716 WP_000742223.1.674 WP_000742223.1.67873 WP_000742223.1.67912 WP_000742223.1.68007 WP_000742223.1.6816 WP_000742223.1.68346 WP_000742223.1.6846 WP_000742223.1.68562 WP_000742223.1.69347 WP_000742223.1.69501 WP_000742223.1.70018 WP_000742223.1.70108 WP_000742223.1.70181 WP_000742223.1.71114 WP_000742223.1.71242 WP_000742223.1.71441 WP_000742223.1.71648 WP_000742223.1.71652 WP_000742223.1.71953 WP_000742223.1.72484 WP_000742223.1.72514 WP_000742223.1.72752 WP_000742223.1.73396 WP_000742223.1.73457 WP_000742223.1.73594 WP_000742223.1.73790 WP_000742223.1.7398 WP_000742223.1.74302 WP_000742223.1.74372 WP_000742223.1.74651 WP_000742223.1.74832 WP_000742223.1.74857 WP_000742223.1.74863 WP_000742223.1.74976 WP_000742223.1.7534 WP_000742223.1.7544 WP_000742223.1.75866 WP_000742223.1.75891 WP_000742223.1.7593 WP_000742223.1.75942 WP_000742223.1.76086 WP_000742223.1.76155 WP_000742223.1.76804 WP_000742223.1.76902 WP_000742223.1.77370 WP_000742223.1.77386 WP_000742223.1.77402 WP_000742223.1.77567 WP_000742223.1.77576 WP_000742223.1.79549 WP_000742223.1.79658 WP_000742223.1.80126 WP_000742223.1.80239 WP_000742223.1.80622 WP_000742223.1.80649 WP_000742223.1.81000 WP_000742223.1.81570 WP_000742223.1.81773 WP_000742223.1.82986 WP_000742223.1.83694 WP_000742223.1.83977 WP_000742223.1.84422 WP_000742223.1.84541 WP_000742223.1.84775 WP_000742223.1.85348 WP_000742223.1.85592 WP_000742223.1.85667 WP_000742223.1.8577 WP_000742223.1.85928 WP_000742223.1.86374 WP_000742223.1.86619 WP_000742223.1.86637 WP_000742223.1.86763 WP_000742223.1.869 WP_000742223.1.87013 WP_000742223.1.87725 WP_000742223.1.87768 WP_000742223.1.87777 WP_000742223.1.87873 WP_000742223.1.87947 WP_000742223.1.88154 WP_000742223.1.88200 WP_000742223.1.88269 WP_000742223.1.88431 WP_000742223.1.89009 WP_000742223.1.8923 WP_000742223.1.89325 WP_000742223.1.89460 WP_000742223.1.89718 WP_000742223.1.90254 WP_000742223.1.90352 WP_000742223.1.90452 WP_000742223.1.90466 WP_000742223.1.90665 WP_000742223.1.91020 WP_000742223.1.91367 WP_000742223.1.91404 WP_000742223.1.93683 WP_000742223.1.93838 WP_000742223.1.94308 WP_000742223.1.94914 WP_000742223.1.9533 WP_000742223.1.95576 WP_000742223.1.9623 WP_000742223.1.96272 WP_000742223.1.96287 WP_000742223.1.96356 WP_000742223.1.96437 WP_000742223.1.9700 WP_000742223.1.97082 WP_000742223.1.97262 WP_000742223.1.97327 WP_000742223.1.97561 WP_000742223.1.97670 WP_000742223.1.97816 WP_000742223.1.97842 WP_000742223.1.97993 WP_000742223.1.98053 WP_000742223.1.98557 WP_000742223.1.98571 WP_000742223.1.9860 WP_000742223.1.98604 WP_000742223.1.99212 WP_000742223.1.99266 WP_000742223.1.99636 gi|384188599|ref|YP_005574495.1| gi|375286522|ref|YP_005106961.1| 226900.BC4525 405532.BCB4264_A4633 405534.BCAH187_A4653 gi|452200994|ref|YP_007481075.1| gi|218233760|ref|YP_002369320.1| gi|558683183|ref|YP_008821312.1| gi|30022602|ref|NP_834233.1| gi|449091476|ref|YP_007423917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]