SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30022727|ref|NP_834358.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30022727|ref|NP_834358.1|
Domain Number 1 Region: 3-70
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 77-160
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000378
Family Tetracyclin repressor-like, C-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|30022727|ref|NP_834358.1|
Sequence length 212
Comment transcriptional regulator IcaR [Bacillus cereus ATCC 14579]
Sequence
MKQTKQKVIDAAISLFNTKGYDGTSVRDIAKRADVNVANISYYFAGKQGLLEQLITDFLE
GYIHVIEMSFEQREYLSAKDVMVQMVRGILRYQFENRELTRFFYRELSLDTTLIREVMTV
YFSKERYYIEQMIRQGQMKQEFQKVSFTMFMTQLKGMISMPFLYPQYISEVLHSFPSETF
FIEMYTKEIEQWMEQALCKANMYHEWPRAVHM
Download sequence
Identical sequences A0A0A3WN96 A0A0K0SEF5 A0A0T8I440 A0A1G1UTP3 A0A229MQY0 A0A243DA29 A0A243J9J4 A0A243JLA5 A0A2J9DJ78 B5UNK3 G9Q0M9 J7ZC97 J8M040 Q817A7 R8ECQ3 R8TE13
226900.BC4652 gi|30022727|ref|NP_834358.1| NP_834358.1.86172 WP_000814923.1.100082 WP_000814923.1.10055 WP_000814923.1.101224 WP_000814923.1.10584 WP_000814923.1.10745 WP_000814923.1.14039 WP_000814923.1.20208 WP_000814923.1.20651 WP_000814923.1.23652 WP_000814923.1.26483 WP_000814923.1.26637 WP_000814923.1.31221 WP_000814923.1.35694 WP_000814923.1.3798 WP_000814923.1.39411 WP_000814923.1.42485 WP_000814923.1.43442 WP_000814923.1.44348 WP_000814923.1.47000 WP_000814923.1.47437 WP_000814923.1.47975 WP_000814923.1.51681 WP_000814923.1.55116 WP_000814923.1.58822 WP_000814923.1.60334 WP_000814923.1.61243 WP_000814923.1.63789 WP_000814923.1.63902 WP_000814923.1.64282 WP_000814923.1.6475 WP_000814923.1.67001 WP_000814923.1.67873 WP_000814923.1.67912 WP_000814923.1.6816 WP_000814923.1.71242 WP_000814923.1.72484 WP_000814923.1.73457 WP_000814923.1.73594 WP_000814923.1.73790 WP_000814923.1.74863 WP_000814923.1.76804 WP_000814923.1.76902 WP_000814923.1.77567 WP_000814923.1.80649 WP_000814923.1.81570 WP_000814923.1.81773 WP_000814923.1.85348 WP_000814923.1.86619 WP_000814923.1.87768 WP_000814923.1.88200 WP_000814923.1.90352 WP_000814923.1.94308 WP_000814923.1.95576 WP_000814923.1.96287 WP_000814923.1.97670 WP_000814923.1.97842 WP_000814923.1.99212 APC25139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]