SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|30023371|ref|NP_835002.1| from Bacillus cereus ATCC 14579

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|30023371|ref|NP_835002.1|
Domain Number 1 Region: 18-88
Classification Level Classification E-value
Superfamily Homeodomain-like 4.04e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 92-203
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000119
Family Tetracyclin repressor-like, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|30023371|ref|NP_835002.1|
Sequence length 209
Comment TetR family transcriptional regulator [Bacillus cereus ATCC 14579]
Sequence
MVKHNVHASVKDEKLVALRREQMIKGAVQLFKQKGFPRTTTREIAKAAGFSIGTLYEYIR
TKDDVLYLVCDSIYEHVKERLEEVVCTEKGSVESLKIAITNYFKVMDELQEEVLIMYQEV
RFLPKESLPYVLEKEFQMVGMFENILEQCTENGTFTLNKKEIQLLAHNIFIQGQMWGFRR
WALQKLYTLEEYTEMQIRYVLQGAHMLPK
Download sequence
Identical sequences A0A0B5NRX9 A0A0D1NUF4 A0A0E1MKX9 A0A0K6MJE0 A0A0T8FKD6 A0A158RNL1 A0A1J9TPA8 A0A1M6FR48 A0A1Q9KU31 A0A229MIN3 A0A242W1J1 A0A243B701 A0A243CRG8 A0A243DLC9 A0A243FA68 A0A243KUZ3 A0A243LDA9 B3ZD66 B3ZQW3 B7JHG3 C2R174 D8H3Z6 G9QC97 J8HY29 J8KNF9 J8L570 J8MFN9 J8N1A5 Q630Q8 Q6HQG0 Q814T0 R8GW82
gi|229602180|ref|YP_002869555.1| APC25248 gi|296505764|ref|YP_003667464.1| gi|225867322|ref|YP_002752700.1| gi|52140222|ref|YP_086609.1| 226900.BC5340 260799.BAS5189 288681.BCZK5040 405535.BCAH820_5433 568206.BAMEG_5629 572264.BCA_5490 592021.BAA_5610 gi|227818103|ref|YP_002818112.1| gi|30023371|ref|NP_835002.1| gi|301056808|ref|YP_003795019.1| gi|49188175|ref|YP_031428.1| NP_835002.1.86172 WP_000238605.1.100059 WP_000238605.1.100082 WP_000238605.1.100214 WP_000238605.1.100409 WP_000238605.1.10055 WP_000238605.1.100595 WP_000238605.1.100912 WP_000238605.1.101931 WP_000238605.1.10208 WP_000238605.1.11387 WP_000238605.1.11427 WP_000238605.1.11676 WP_000238605.1.12553 WP_000238605.1.13115 WP_000238605.1.13221 WP_000238605.1.13233 WP_000238605.1.1354 WP_000238605.1.13820 WP_000238605.1.14006 WP_000238605.1.14174 WP_000238605.1.14176 WP_000238605.1.14721 WP_000238605.1.14855 WP_000238605.1.14882 WP_000238605.1.15163 WP_000238605.1.15460 WP_000238605.1.15569 WP_000238605.1.16013 WP_000238605.1.16156 WP_000238605.1.16997 WP_000238605.1.17146 WP_000238605.1.17424 WP_000238605.1.18914 WP_000238605.1.18976 WP_000238605.1.19258 WP_000238605.1.19435 WP_000238605.1.19438 WP_000238605.1.19445 WP_000238605.1.195 WP_000238605.1.20208 WP_000238605.1.20390 WP_000238605.1.20651 WP_000238605.1.20665 WP_000238605.1.20680 WP_000238605.1.20865 WP_000238605.1.21021 WP_000238605.1.21258 WP_000238605.1.21776 WP_000238605.1.226 WP_000238605.1.22699 WP_000238605.1.22865 WP_000238605.1.23269 WP_000238605.1.23540 WP_000238605.1.23615 WP_000238605.1.23652 WP_000238605.1.23873 WP_000238605.1.2419 WP_000238605.1.24334 WP_000238605.1.24556 WP_000238605.1.24608 WP_000238605.1.24676 WP_000238605.1.2521 WP_000238605.1.25290 WP_000238605.1.25316 WP_000238605.1.25599 WP_000238605.1.2569 WP_000238605.1.25716 WP_000238605.1.25752 WP_000238605.1.26000 WP_000238605.1.2618 WP_000238605.1.26513 WP_000238605.1.26637 WP_000238605.1.26665 WP_000238605.1.26721 WP_000238605.1.26826 WP_000238605.1.27644 WP_000238605.1.27987 WP_000238605.1.28237 WP_000238605.1.28427 WP_000238605.1.28729 WP_000238605.1.28913 WP_000238605.1.29101 WP_000238605.1.29451 WP_000238605.1.29787 WP_000238605.1.29804 WP_000238605.1.30110 WP_000238605.1.30216 WP_000238605.1.3026 WP_000238605.1.30317 WP_000238605.1.30336 WP_000238605.1.31490 WP_000238605.1.31503 WP_000238605.1.3236 WP_000238605.1.32576 WP_000238605.1.32784 WP_000238605.1.32927 WP_000238605.1.33175 WP_000238605.1.33201 WP_000238605.1.33338 WP_000238605.1.33367 WP_000238605.1.33536 WP_000238605.1.33717 WP_000238605.1.33740 WP_000238605.1.33828 WP_000238605.1.33876 WP_000238605.1.34158 WP_000238605.1.34646 WP_000238605.1.35684 WP_000238605.1.35886 WP_000238605.1.36221 WP_000238605.1.36763 WP_000238605.1.3699 WP_000238605.1.38036 WP_000238605.1.38345 WP_000238605.1.39781 WP_000238605.1.40034 WP_000238605.1.40550 WP_000238605.1.41165 WP_000238605.1.41365 WP_000238605.1.41464 WP_000238605.1.41518 WP_000238605.1.41675 WP_000238605.1.42217 WP_000238605.1.43442 WP_000238605.1.4439 WP_000238605.1.44428 WP_000238605.1.44483 WP_000238605.1.44956 WP_000238605.1.45305 WP_000238605.1.45533 WP_000238605.1.45919 WP_000238605.1.46236 WP_000238605.1.46326 WP_000238605.1.46476 WP_000238605.1.4649 WP_000238605.1.46549 WP_000238605.1.46699 WP_000238605.1.47145 WP_000238605.1.4763 WP_000238605.1.47644 WP_000238605.1.47798 WP_000238605.1.47975 WP_000238605.1.4865 WP_000238605.1.4964 WP_000238605.1.49831 WP_000238605.1.5025 WP_000238605.1.51072 WP_000238605.1.51167 WP_000238605.1.51335 WP_000238605.1.51749 WP_000238605.1.52494 WP_000238605.1.52794 WP_000238605.1.53137 WP_000238605.1.53493 WP_000238605.1.53683 WP_000238605.1.53879 WP_000238605.1.54117 WP_000238605.1.54189 WP_000238605.1.54240 WP_000238605.1.54547 WP_000238605.1.54736 WP_000238605.1.55116 WP_000238605.1.55811 WP_000238605.1.55958 WP_000238605.1.55968 WP_000238605.1.56042 WP_000238605.1.56176 WP_000238605.1.56270 WP_000238605.1.56318 WP_000238605.1.56320 WP_000238605.1.56580 WP_000238605.1.56959 WP_000238605.1.57732 WP_000238605.1.58160 WP_000238605.1.58822 WP_000238605.1.59058 WP_000238605.1.59095 WP_000238605.1.59173 WP_000238605.1.59575 WP_000238605.1.59978 WP_000238605.1.59997 WP_000238605.1.60153 WP_000238605.1.60334 WP_000238605.1.60402 WP_000238605.1.60841 WP_000238605.1.61213 WP_000238605.1.62107 WP_000238605.1.62300 WP_000238605.1.6304 WP_000238605.1.63137 WP_000238605.1.6340 WP_000238605.1.63560 WP_000238605.1.63611 WP_000238605.1.63902 WP_000238605.1.64282 WP_000238605.1.64491 WP_000238605.1.64568 WP_000238605.1.65803 WP_000238605.1.66357 WP_000238605.1.67001 WP_000238605.1.67108 WP_000238605.1.67239 WP_000238605.1.67873 WP_000238605.1.67912 WP_000238605.1.6846 WP_000238605.1.68562 WP_000238605.1.68607 WP_000238605.1.69203 WP_000238605.1.69323 WP_000238605.1.69822 WP_000238605.1.69894 WP_000238605.1.70065 WP_000238605.1.7096 WP_000238605.1.70996 WP_000238605.1.71114 WP_000238605.1.71895 WP_000238605.1.73325 WP_000238605.1.73396 WP_000238605.1.73594 WP_000238605.1.73790 WP_000238605.1.7398 WP_000238605.1.74226 WP_000238605.1.74337 WP_000238605.1.74538 WP_000238605.1.7545 WP_000238605.1.75499 WP_000238605.1.75870 WP_000238605.1.76125 WP_000238605.1.76155 WP_000238605.1.7628 WP_000238605.1.76783 WP_000238605.1.76902 WP_000238605.1.77668 WP_000238605.1.77824 WP_000238605.1.782 WP_000238605.1.7856 WP_000238605.1.78644 WP_000238605.1.79315 WP_000238605.1.79584 WP_000238605.1.80126 WP_000238605.1.80439 WP_000238605.1.80649 WP_000238605.1.80695 WP_000238605.1.81799 WP_000238605.1.82289 WP_000238605.1.83951 WP_000238605.1.84045 WP_000238605.1.84422 WP_000238605.1.85348 WP_000238605.1.85592 WP_000238605.1.85689 WP_000238605.1.85901 WP_000238605.1.86119 WP_000238605.1.86140 WP_000238605.1.86239 WP_000238605.1.86288 WP_000238605.1.8698 WP_000238605.1.87768 WP_000238605.1.88154 WP_000238605.1.88200 WP_000238605.1.8825 WP_000238605.1.88269 WP_000238605.1.88641 WP_000238605.1.90155 WP_000238605.1.90254 WP_000238605.1.90596 WP_000238605.1.90791 WP_000238605.1.90883 WP_000238605.1.9186 WP_000238605.1.9269 WP_000238605.1.93271 WP_000238605.1.93744 WP_000238605.1.93838 WP_000238605.1.93893 WP_000238605.1.93927 WP_000238605.1.94237 WP_000238605.1.94322 WP_000238605.1.94373 WP_000238605.1.94784 WP_000238605.1.95308 WP_000238605.1.9533 WP_000238605.1.95576 WP_000238605.1.96437 WP_000238605.1.96934 WP_000238605.1.97149 WP_000238605.1.97262 WP_000238605.1.97781 WP_000238605.1.97842 WP_000238605.1.97861 WP_000238605.1.97993 WP_000238605.1.98216 WP_000238605.1.98557 WP_000238605.1.98604 WP_000238605.1.99212 WP_000238605.1.99445 WP_000238605.1.99454 WP_000238605.1.99485 WP_000238605.1.99994 YP_031428.1.16718 gi|218906519|ref|YP_002454353.1| gi|376269256|ref|YP_005121968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]