SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261417249|ref|YP_003250932.1| from Fibrobacter succinogenes subsp. succinogenes S85

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261417249|ref|YP_003250932.1|
Domain Number 1 Region: 19-224
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 3.92e-21
Family Archaeal IMP cyclohydrolase PurO 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261417249|ref|YP_003250932.1|
Sequence length 244
Comment hypothetical protein Fisuc_2868 [Fibrobacter succinogenes subsp. succinogenes S85]
Sequence
MNYTEEAKQNFNDLSKNPYPGRGIVLGTSADGKSYVQVYWIMGRSVNSRNRVFEIEADTG
FMKTKAFDESKLTDPHLIIYYPARHTKDVQIITNGDQTDTIYNAIKLGGTFESALRTRQY
EDDAPNFTPRISGIHYKNAEPAIYKLSILKSRNNSEDAGCERMTFEFEKALPGLGHFIST
YETDGKPIPSFNGFPKLMPIFNSAEETLKAYWDALNADNKVSLMVKWIDRETFEAKTIIV
NKNV
Download sequence
Identical sequences WP_015732441.1.27150 WP_015732441.1.74657 59374.Fisuc_2868 gi|261417249|ref|YP_003250932.1| gi|261417249|ref|YP_003250932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]