SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|42523844|ref|NP_969224.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42523844|ref|NP_969224.1|
Domain Number 1 Region: 780-870
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000000000000022
Family Intein (protein splicing domain) 0.011
Further Details:      
 
Domain Number 2 Region: 138-212
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000209
Family PKD domain 0.0037
Further Details:      
 
Domain Number 3 Region: 249-291
Classification Level Classification E-value
Superfamily PKD domain 0.00000000157
Family PKD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 516-564
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000105
Family TSP-1 type 1 repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42523844|ref|NP_969224.1|
Sequence length 913
Comment cell surface protein [Bdellovibrio bacteriovorus HD100]
Sequence
MNYGRVLLPLSLIVLAGCQKSALSEGSADTMEAASYCAGQLSKASSEDVRIVGKSATEAG
STVSYSLDQAGNCVSSSDVTWKVAGASRTKTSASGMTSTFKLAGTYVVTAQEKTSGSEDI
SLSLVTTVVKEDLKISGPQAGFVFNPMSFEVVIPSGVDAQSIVWNFNDGTATVSNARTVE
HSFFNVGTYQVQATVTDADGKVTVASHRVTVMTVIDDMDCLEDLRISGANEAKVKIATMM
HVYLPACLVNKVGAVRWNFGDGGTAANQSVTHAYQTVGTYAVTATLYLGDNQEPWVTLDH
SIRVIEDLDVDPEPEVPVDPNACTVAGATRESQGELVSEEVACGVNGKKTVSYRDRVVEE
CKLVVEKLNWVEVSRTKEITNEGSCEGQSCKLPDGSLLAHGASQVLYSNSTPVGSCSSVS
ESRTCNNGVLSGSSTHNQVTCHEGCGSFGSHGTVKTGVITGETKVPLKCSFNEEGFFDLY
NEISDQTCTDGQIISSNTRQGTMKEAGKCPVYKYAPTDNFTACTADCGGKQNRIFVCVDD
KGVTVDDSRCADQVKPVEERLCDANPEAVRSQSSVTTIEEANSSATCPANQIGVIVKTRE
VVTTKTMACIDHSVQLESEVAVPGAWVEEKYCRDYVARRCSHDSLSNTEAKGRYDWMVKC
QDELPVIKEFLTSFANVTVTVGGKKVGLGSSGQEIYATFMDRAYNPEKAWIAPKKANAPC
TMPATAYVATVCVSSCATPEQQILAEEVVSKKLKYMSFFDALTSQSAYVGTMQSADSLNK
NAVVKTKVDQWVTELVDGDHEILVFKMKSGRELRVTKNHPILSQDGSMKVAEEFKVGESL
VQSGGTLDAIVSINEIKYFGKVYNVFVQSNAPHKNVVLINGYLNGSAFFQNAGAKEMNRT
IFRNNMTRGVFGK
Download sequence
Identical sequences Q6MKJ0
264462.Bd2400 WP_011164819.1.10133 gi|42523844|ref|NP_969224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]