SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|42524857|ref|NP_970237.1| from Bdellovibrio bacteriovorus HD100

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|42524857|ref|NP_970237.1|
Domain Number - Region: 70-124
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0902
Family TolA 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|42524857|ref|NP_970237.1|
Sequence length 134
Comment hypothetical protein Bd3504 [Bdellovibrio bacteriovorus HD100]
Sequence
MKQGYTLNLKEYRLKEVTLFALITLILSSCSNVPTREERLDATEKATNRTLDQNQDAFKS
CIQDALKRSPGLDGRATLVWIQNEDGFVKNPRIRDMNFKDPAFEDCIISKIKVMKFPPSA
EDSRAKVSLELLVK
Download sequence
Identical sequences Q6MHN6
WP_011165834.1.10133 gi|42524857|ref|NP_970237.1| 264462.Bd3504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]