SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22002765m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22002765m.p
Domain Number 1 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.47e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 208-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 54-109
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.5e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 112-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 16-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22002765m.p
Sequence length 265
Sequence
MCHSLMESKMVQREKKSFHCEICDKQFKRSWQLSEHLRTHTGEKPYHCGICRKAFSCNSS
LRRHRTVHTGERPYQCKICSKTFSFSSNLKNHIMTHAGMSPHQCEICGKTCTSNSNLTKH
VMVHTGERPFNCEICGKSFMSSSNFKMHKMLHSGDSPFQCEICSKSFSSNYNLNKHMTVH
TGEKPFNCEICGKAFSRRCHVTRHNVVHTGEKPFQCEICDKAFSSNYNLSIHVMVHTGER
PFNCEICGKSFSRKSHVTRHNKSCN
Download sequence
Identical sequences A0A0L8G0F7
Ocbimv22002765m.p XP_014785217.1.24776 XP_014785219.1.24776 XP_014785220.1.24776 XP_014785221.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]