SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22034768m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22034768m.p
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily PH domain-like 0.00000295
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22034768m.p
Sequence length 142
Sequence
MKSVREVQRLSSKIKRSAIAILTREDYSWALSFETDGDAEDWLNVVLLEHQKRGDAKFFT
SPGIHKQIRSDLKADQYDVYPVCPMAYTPLGDFHGECLMVLTPETIHLLDAGQPTCCLAT
WQMKQLKKFQLNSRCLSLEVGK
Download sequence
Identical sequences A0A0L8GFV8
Ocbimv22034768m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]