SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22037048m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22037048m.p
Domain Number 1 Region: 20-159
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000143
Family Pentapeptide repeats 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22037048m.p
Sequence length 201
Sequence
MKYRTSRLEGTYVRSGQEQRTKFRSSRIERTYVRSSHDQRTKCRSSRLERTYVRSGQQQR
TRFRSSRHEGTYVRSGQGQRTKFRSSWLERTYVCSGQEHRPKFRSSRLERTYLRSGQEQR
TKFRSSRIEGTYARSGQEQRTKFRSSRLERMYIERMDVRSSKRYERSSVSILEITNEITM
NKRNNKRLHERTNEITNERKK
Download sequence
Identical sequences A0A0L8GAC9
Ocbimv22037048m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]