SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22004488m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22004488m.p
Domain Number 1 Region: 5-56
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 0.0000275
Family Archaeal IMP cyclohydrolase PurO 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22004488m.p
Sequence length 60
Sequence
MDKGRNFKYKRCIFKQHVEATDGHGKQSIKDIYIIYHITKVIDNIEVAWNGLTLDCMNRF
Download sequence
Identical sequences A0A0L8HW37
Ocbimv22004488m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]