SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22004640m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22004640m.p
Domain Number 1 Region: 47-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 125-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 88-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000061
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22004640m.p
Sequence length 229
Sequence
MEKKLNYKTQCKKIGFSETAHLRSHKYTQTSEKSHCDICGKLFNRKNIAVHKRSHTGEKP
YQCDICGKTFSQSCAVIKHKRTHTGDKPYRCDICGKSFSESHNLSRHKRVHTGEKPFCCQ
ICGTSFTLNHHLTRHKHTHTGGKPYQCVTCGKSFSQNVHLTKHKRIHTGEKPYCCVTCGK
SFSRNDQLTNHIRTHTGERPYHCDTCGKSFSENSSLIKHSHIHHSKLIP
Download sequence
Identical sequences A0A0L8HVZ1
XP_014768943.1.24776 XP_014768945.1.24776 XP_014768946.1.24776 XP_014768947.1.24776 XP_014768948.1.24776 Ocbimv22004640m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]