SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22006985m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22006985m.p
Domain Number 1 Region: 42-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-24
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 2 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22006985m.p
Sequence length 254
Sequence
MEDEGCGKKIKYEKQFKRIDFPDDKKKAKEKTFYQCDTCGKSFTRRGNLTTHERSHTGEK
PFPCDVCGKAFSQKGNLTAHKRTHTGKKPYRCDTCGKSFSQNTVLTKHKRIHTGEKPYHC
DICGQSFSIDHNLTNHKRIHTGEKPYLCNICGKSFSQSSVLTKHKLIHTGEKPYHCNICG
KSFSHKGNLVTHKYTHTGEKPYRCNICGKSFSINFNLSTHKHIHTGEKPYYCDICGKSFS
HKGTLTKHTLIHKQ
Download sequence
Identical sequences A0A0L8HSQ0
Ocbimv22006985m.p Ocbimv22006986m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]