SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22007990m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22007990m.p
Domain Number 1 Region: 84-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 141-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 3 Region: 48-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-19
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 184-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22007990m.p
Sequence length 249
Sequence
MEHDNKLDNSKRNVFTDVDSVARAYKGDEEKPLGCKTFTKQKSLHRNTQCDLCGKSFANS
SNLTKHKRIHSGEKPFSCEVCGKSFIMNSHLARHERIHTEEKPYHCEICGKSFIRNSILI
THIRIHTGEKPCFCEVCGKYFFSDSNLTRHKKLHTGKRPFYCEVCGKSYCNNSELRRHKN
VHTGEKRFYCEICGKSFFDHFNLVVHIRSHTGERAYRCEICGKSFITNSHLKRHKRTHTA
GKSFDYRDT
Download sequence
Identical sequences A0A0L8HRL9
Ocbimv22007989m.p Ocbimv22007990m.p XP_014770050.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]