SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22009214m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22009214m.p
Domain Number 1 Region: 167-263
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-24
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22009214m.p
Sequence length 271
Sequence
MATDPLNMAGRNGIVVPSTSTRQAIAKSFQLEYCWFCGRPMDFFSLSSDNDHMEKLSELE
RLLAQAQNEKMHLIDEQVKQRESEMVALQEERLKREELERKLQEEALLREQLVQQQVQLR
EKQIQQARPLTRYLPIRNKDFDLRQHIEAAGHNLDSCPLVIVTMTSCRGYLQKMGSKFKT
WHKRWFFFDRMKRSLLYYSDKNETKARGGIYFQAIEEVYVDHLRTVKSPNPKLTFCVKTY
DRTYYLVGPSAEAMRIWIDVIFTGAEGYHTF
Download sequence
Identical sequences A0A0L8HQ64
Ocbimv22009214m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]