SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22009397m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22009397m.p
Domain Number 1 Region: 308-584
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-55
Family Kelch motif 0.0006
Further Details:      
 
Domain Number 2 Region: 55-152
Classification Level Classification E-value
Superfamily POZ domain 4.4e-31
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22009397m.p
Sequence length 601
Sequence
MDNGATSASPEDSIYNSKNLNINNIPAMDCMKISQNKIKYINKNYQKFPHKIYDSKCDIK
LSVGGTSFRVHKQVLSEASDYFSAMFHHDMKEKEQDAIEIKDISPKGFSAILDYFYHGNI
TISPENIEDVLEVARFFQADWIVDVCCNFLVEYMSLENYTYVQNLADKFALGDLQPDILQ
VLALSINELVEQPKFIQNLPENLLLAFLQCDIYVEAHEHFLFKLILDWVDEDPCTRKPSL
LPLLKEIRFSLMELEELESIPDLVHELEEIHNEVEFAKNYALCIQAQCLQNDDKFLPRGA
HSVLTMIFFPDDMCTNIAYKDPDNPGLCVEELDSPLHIRYEHTRETVLGNFLFVAGGYTT
NYCSSNCVFMYDPRFRTWTEIASMQNPRVSFAMCSSDHNLFVLGGINHMFVDNNEVEVIL
QNCEMYFPEENVWVAIPDLPLGIFDHASAFANDCLYCSGGITDNPENTVPVSFLYVYSFS
TKTWETKAEMLYPHQRHCMMAIDNKLFVLGGYTRDNEIGFKDCLTNECYDAETNQWTEII
STPLEYGLLQSHATQLENKIYIIGGEKTNLYAYDIEKNTFEELELLDPKIQRVSCLDVAY
P
Download sequence
Identical sequences A0A0L8HR43
XP_014770543.1.24776 Ocbimv22009397m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]