SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22009425m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22009425m.p
Domain Number 1 Region: 933-1224
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.57e-54
Family Complement components 0.00025
Further Details:      
 
Domain Number 2 Region: 1297-1419
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.41e-25
Family Alpha-macroglobulin receptor domain 0.0008
Further Details:      
 
Domain Number 3 Region: 758-852
Classification Level Classification E-value
Superfamily E set domains 0.000000238
Family SVA-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22009425m.p
Sequence length 1680
Sequence
MTVWGFKEDQSLIFSKTIDDLKIVNKNTLTFVQTDKYMYIPGQTVKFRIVTTNINLMSKP
GLISEVAVLNPNGIKMKKWADIFNQKGLLSFKFQIAPQPVLGKWKIKVVDGSKFTDFEFE
VQKYVLPKFEVSIEGPSYLLVNTKRFDVKVCSHYSQGKEIQGQMESKICIRTTDEEDERP
CATYHAEICGCNNFSVNTSEVGLSLNKYSLKDAFLEITASVTDVETKMVVNSTVYGPEIK
NEYVKIDLKFSQGYFKPGFTYYGKVLVSKPDNSIAAGEVIEVTAVDFVNDIELAGIFTSN
ENGEIDFTIDHFDKYTEEFVLQARSINGTFVNEDSHHYMYTPIDTFTVKQWFSRMGKYLQ
IKPLEKNLRCHSKLNLNILYTATLRERINLYYLVMSKSQIVANGQIAFRADHRYVYRKEH
FNNSLKISADPDDEVLSMMPYSNQTQSSPGYQKDAKHKHINYKNKKHTKRENNRRSDSAP
FMAKLEFDIDIIPEMSPLSYILVYLVDDNGELVDDYQEFSVNSCFKNEVEFDIPKGPLYP
NDYITFNLKTTGNSVCAINLADRSTFSGWDNWVTEQQVFNKLKEHHFQLSRFYSAEDKHC
QKILMETQHGIEMNEHRKKRVASVYSSRYVDAMFAFKGSGLTLISDINLETRPCTWLQAP
VDLPSEEATDVLWEQFYNVPETTTADTSVAEDAFMPEERFGILDYFSETWLWKDLETRKH
EKLLLKTKVPSPATEWIGNVFCSSETDGLGLLALPTISVFQPFSISYIMPYTGIVGERIP
ISITIQSNIKKCLTIGLQVKVSSNSEKTPKEIKGPVSCLCKEEYITTNIYLNDLPIGVIN
VTVQGKSILPNNRRCSKKTVDSRYIGMIDSSSAFINMRPKGFVQEITHSEYVCPSEDHGG
NYVNVLSTELPKDTVPGSVKAEINMFGNMLWPGLSSLENIVNDPITNGEGNILSLAATIY
VMDFLNAVGKVSYEIEMKAIEIMEKCYQQQMNYIHKNGSFSIFGSQDKEGSELLTAFVLR
ILVKARSYIYIDEVQLQKSISWLRDQQLENGCFYDKLNYSLTFGLYEDRKNMERISTAFV
IMALLEFGTPQHDLIIDKGLNCLRSHDYEDIYMLSLYAYVFTLYGHAESDKEKYQNVLER
RSKVLGEETFWLNSEDSNSITSMDIEATSYALLSLLGTEATSKWQDLRPVIRWLTKQRKP
MGGFMAAKDSVIAFQAISQYALMWSERQDPADITIYIDNEYDPTETFQLTNQNQFELFTY
AKPLKNKIRIDAEGRGCGIVQTSLKYNVLNLKQEQSFHLRVGVENSYKNCAERKLKICSR
YTGRSEKTNIVIMEVKMLTGWIPQQIVDPKHAERVGVKKYEMTEDYVYLYFDEMNKTAKC
IEIEIEQVLALSSLPAGVVVYDYYDRDVIGHTLYGLKTTCGTKEELPVVSQETYENSMTQ
QRQPIGLPPALQKLLKLKSKNVNHMNAAAETASSITENQQSESAIVPNGTQVINTANSTF
NATSPRRKTVAEISITLKTTSVSFLTEYAEPIPVTTASSTNVSAEASKEPILVNLSRNHK
KKNCPVCWDNVPKDYHKLFCNAVEVYKISSGKNKEHLIRVMADLRPVKKLQIKKFVVPKM
DKSCECACIKEKGRRVLMRMKAGPKFKDMGPVRLDKHVVIFQLKSVVERHMRRLAKSCKR
Download sequence
Identical sequences A0A0L8HPM6
Ocbimv22009425m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]