SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22009501m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22009501m.p
Domain Number 1 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-21
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 222-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000159
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 265-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000842
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22009501m.p
Sequence length 325
Sequence
MLCEQLSGASEATFFTLLPVSNTVTVSSSSPPPPPASSSFQTFSPFSPTPSFSSLTSSFP
TSAATISSPSFLPSSSLTVPPVSADSAASTAVTVQNDVFTDALSLALALRSATEENGSCE
IGGGEGVIVSEEVEDASSVLQYVCEHCGKQFPNDHILSIHRRAHTINGTRPYQCKFCDKA
FSGSHNLIKHIRTHTGEKPYACCICSKAFADAGQRKVHMRTHTGEKPFECELCGKMFSQS
CNLRSHMATHSGIRPYHCPHCLKDFARASTLLQHKFHNQGQNGSLECPFCDQVFEHKCSL
SVHLRTHPRESRNKDSKTKQKNLAT
Download sequence
Identical sequences A0A0L8IET6
Ocbimv22009501m.p XP_014771892.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]