SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22010173m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22010173m.p
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000105
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 2 Region: 144-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000044
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22010173m.p
Sequence length 266
Sequence
NCSEGEQSTSSDSCVKCVIGTYRPAKDPVCIKCPSDFLTNGEGKTSEADCIIPPCNEGTY
YNGSKCLNCALDEYQDEKYQRTCKSCPNGKYTSSEGTKDATSCTTYCKARKNVCPQNAIC
VDTDSGHNCTCITGYVLISNGTCVYACDTVYCLNGGTCARSRSLPMCICTKYYKGTICEQ
ELSASELSKNTTDIIIGTSIGVTVAILFLILLITYICIRMRKSPRGDLAENGSHLHPFYE
PVSKAHSVPYTNSLYEFSNSLSQSKR
Download sequence
Identical sequences A0A0L8FRA6
Ocbimv22010173m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]