SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22010284m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22010284m.p
Domain Number 1 Region: 42-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.61e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 155-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.23e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 200-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22010284m.p
Sequence length 254
Sequence
MENELREKAVKRKTENKKTHFPKVILKGVGKASYHCDVCNKTFSLKGNLTTHKRIHTGEK
PYHCSICAKSFSQRSSLTTHRRIHTGEKPYHCDICDKSFSVIGNLTTHIRSHTGEKPYHC
VICGKSFSGSSDLTIHKRIHTGEKPYRCYVCGKSFAGNRDLTTHKRIHTGEKPYHCDICG
NLFTQRSSLNTHLHIHSGVKPYHCDTCGKSFSAPGNLTTHKRTHTGNKPFNCDICGRSFS
RNSDLTTHIRIHTG
Download sequence
Identical sequences A0A0L8FS06
Ocbimv22010283m.p Ocbimv22010284m.p Ocbimv22010285m.p XP_014787654.1.24776 XP_014787655.1.24776 XP_014787656.1.24776 XP_014787657.1.24776 XP_014787658.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]