SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22014368m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22014368m.p
Domain Number 1 Region: 190-452
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.83e-77
Family Mitochondrial carrier 0.0000607
Further Details:      
 
Domain Number 2 Region: 9-165
Classification Level Classification E-value
Superfamily EF-hand 3.53e-39
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22014368m.p
Sequence length 463
Sequence
MSSSPDNTHHELSREEKEKLSALFNRLDVNKDGSIDIHDLSAALSQMEVPQVPGQAQRFF
EKTDVSKDGQVNFAEFVQYVAEHEKKLRLFFRNIDTNQDGAIDVSEIITSFKNLGLHVDQ
AEAEKLLQRMDKDGTLKIDWDEWREYLLLHPSQNIHDIIAYWRHSTVIDIGENVIVPDDF
TEKELQSGMWWRYLVAGGTAGAVSRTCTAPLDRLKVLQQVHGKSGIRSGFKHMLEEGGVK
SLWRGNGINVFKIAPESALKFSFYENIKSLFKKDKHELGMAERFISGSLAGAISQTIIYP
MEVLKTRLAVRKTGQYKGIFDCAKQLLANEGLSCFYKGYIPNLIGILPYAGIDLCVYETL
KSMYLARSKSKQDPSIFVILACGTISSTCGQLTSYPLALVRTRLQAHGASHTMTSMFKDI
LRKDGFRGLYRGLTPNFMKVAPAVSISYVVYEHTRTALGVSST
Download sequence
Identical sequences A0A0L8FN13
XP_014788605.1.24776 Ocbimv22014368m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]