SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22016281m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22016281m.p
Domain Number 1 Region: 80-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 164-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-20
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 221-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.82e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 44-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-16
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 127-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000423
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22016281m.p
Sequence length 326
Sequence
MEDGNDSDTFDSIDSVKQTSGDEKPASPSKKTLSRKEQSSKRNLYCEICGKSFTYNFCLI
IHKRTHTGEKPFHCDVCGKSFADKSCLPSHKRIHTGEKPYHCDTCGKSFARNTALKIHKT
IHTGEKPFQCNMCGESFSTTKSVRVHKRKHIEGSLYNCQICGQSFLMKSHLAKHKTIHTG
EKRFHCEICGMSFAIKGSLTSHKRVHTGEKPFFCDICEKYFYCKSNLTRHKLQHIGEKAF
HCDVCGKSYFNNCDLKRHKRIHDGEKTFHCEICGKSFFDNCNLIAHIRSHTGERPYHCDV
CEKSFTYKSHLNTHKQKHTGDSPLLL
Download sequence
Identical sequences A0A0L8FL97
Ocbimv22016281m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]