SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22018769m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22018769m.p
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 138-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 82-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 43-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000506
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22018769m.p
Sequence length 271
Sequence
MKEVKIDYINIKEEHVTLAIDQQKNEKVKEQIFPEDKKKRTRKLSHDCDVCKKSFSQKGR
LNKHKCVPTIEKPFYCGICGKSFSNQNDFNSHKCVHTRKKRFCCDICGKSFSASGKLTSH
KRIHTGETPYHCDVCGKSFSDRSAFNCHERVHTGEKPYQCNICCKSFSQKSALTSHKRIH
AGEKPYSCNICGKSFPRNYALTDHRRVHTGEKPYQCDICNKSFSASRTLTTHKRIHTGET
PYHCDICGKSFSKWQLIFSQTFPYRRETIFL
Download sequence
Identical sequences A0A0L8HAP3
Ocbimv22018769m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]