SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22018772m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22018772m.p
Domain Number 1 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 33-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-23
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 3 Region: 187-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-19
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 4 Region: 75-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22018772m.p
Sequence length 245
Sequence
MEKSKKLKDLTFPKDREKERGKLSHDCDVCKMSFSKRCNLTKHKRIHTGEKPFHCDICDK
SFSASGDLTRHKRIHTGEKPYHCDICDKSFSGSNGLNRHTRIHTGEKLYNCDICGRSFLK
IIALTSHKRIHAEEGLFHCGTCGKMFSQSNDLTKHMRIHTQEKPFHCDVCGKRFSQSNNL
TTHIRIHTGEKPYHCDICGRSFSVNGTLTTHKRIHTSEKPFRCDTCSKSFSRSTSLTRHK
CVYRS
Download sequence
Identical sequences A0A0L8HBC9
Ocbimv22018772m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]