SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22020490m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22020490m.p
Domain Number 1 Region: 86-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 141-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 187-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 49-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000023
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22020490m.p
Sequence length 249
Sequence
MEDINHFDNSETIVFNDIETVTLTDRDEKPLYSETFTNQRSLYEDLPRYSCEICRKTFTS
QLDIFMHKEIHNKEKTFRCEICGKYFVSTSVLTKHKLIHTGEKPFHCDICGKSFTQNSNL
VVHQRIHTGEKPYECDLCGKSFVNKSHLVTHIRSHTGEKPFHCEICGKAFSTNFLLKTHR
QIHTGQKLFHCEICGNSFTQNSHLVIHIRSHTGEKPYHCEICEKSFLTNSHLKRHKRIHS
RGKPFNSET
Download sequence
Identical sequences A0A0L8H835
XP_014774681.1.24776 Ocbimv22020490m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]