SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22021622m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22021622m.p
Domain Number 1 Region: 284-327
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 2 Region: 704-746
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000115
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number 3 Region: 168-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000157
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number 4 Region: 390-433
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000377
Family Fibronectin type I module 0.071
Further Details:      
 
Domain Number 5 Region: 754-795
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000492
Family Fibronectin type I module 0.06
Further Details:      
 
Domain Number 6 Region: 225-267
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000167
Family Fibronectin type I module 0.029
Further Details:      
 
Domain Number 7 Region: 602-653
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000167
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 8 Region: 657-696
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000282
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number 9 Region: 338-380
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000471
Family Fibronectin type I module 0.03
Further Details:      
 
Domain Number 10 Region: 448-493
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000596
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number 11 Region: 62-110
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000952
Family VWC domain 0.025
Further Details:      
 
Domain Number 12 Region: 852-893
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family Fibronectin type I module 0.066
Further Details:      
 
Domain Number 13 Region: 803-844
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000178
Family Fibronectin type I module 0.056
Further Details:      
 
Domain Number 14 Region: 901-942
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000356
Family VWC domain 0.075
Further Details:      
 
Domain Number 15 Region: 548-590
Classification Level Classification E-value
Superfamily FnI-like domain 0.000046
Family Fibronectin type I module 0.038
Further Details:      
 
Domain Number 16 Region: 114-156
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000785
Family Fibronectin type I module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22021622m.p
Sequence length 948
Sequence
MIVHNSLPKKFCTYKGHEYRIAQVFLGDDGCSKCSCPASGEVTCVKQTCVIKKEVVTTTS
APFCVYNGFKYNKNEEFAGIDGCSKCSCTESGVVACIKQMCSELDNNPAPTPQTVCIYNE
HTYQVEEEFEGADGCSKCQCSGSGLVTCVKQVCSKSRNGEESRQKKSYSVCRYNGQIYIF
GQTFTAVDNCNQCGCKANGNIVCTKTICPATTTQVITVEKGDTSAVCRYHGKVYIFGQTF
ISIDKCNQCSCRSKGKVECTQKICSSQGEAHLLEITTEKFDLFAICHYNGHVYIFGQTFP
SVDKCNQCSCKSKGVITCSKRTCPPPRMQATTKIDIKVECRYNGKIFVFGQTFIAIDKCN
HCICKFKGKISCTKEKCQETTTQKTRESSSVCRYNGQVYIIGQIFVAIDKCNRCSCKPEG
IIICTKQTCSSPQKEAYLTESGERKLKTFAVCRYNGRTYVFGETFTAEDKCNECSCKRKG
AVICTKKPVCSPSISEISVKCHYNGKTYNIGVTFDAADKCNKCTCKAKGNVDCTTNICVF
SEKHEISVKCKYGTKIYIVGETFPATDNCNKCSCKSKGIVECTKSICLSTGSQETTTHKI
DIFAVCHYYGHIYIFGQTFKSVDRCNQCSCQSKGNTVCTKKKCTSMTTPEAPITLIACHY
NGKVYKFGQTFAAIDKCNQCACMTKGSVMCTKKICFSKTIQVKTECYYNGKVYIIGQTFI
AIDKCNECTCKPAGAVMCTEEICPLSKTTVTKIECHYNGKVYVIGQTFIAIDKCNQCTCK
STGVVVCTEGICPLSKTTVTKIECRYYGKVYVIGQTFIAIDKCNQCTCKYTGAVVCTEKI
CSISKTSVTKVECHYYGKVYVIGQTFIAIDNCNQCICKFTGDILCTEKTCPLSKTTVTKI
ECRYYGKVYVTGQTFIAIDNCNQCICKFTGDILCTEKTCPLSKTTGNN
Download sequence
Identical sequences A0A0L8H7D8
Ocbimv22021622m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]