SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22024026m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22024026m.p
Domain Number 1 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 43-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22024026m.p
Sequence length 257
Sequence
MENKLGEDGAKRKTQSKKIDYTEEMSKDAGKVLYYCDICKKCFSRKRTLTTHKRTHTGEK
PYHCDICGKSFSQNHDLTKHKRIHTGEKQYRCDICGKSFSRNDHLNIHKHTHTGEKPYHC
DICGKSFSRNDHLATHKNIHTGEKPYHCNICGKSFSEGSTLIKHKRIHTGEKPYRCDICG
KSFSDGSTLTKHIRIHTGEKPHDCDICGKSFSQIGNLTKHKLIHTGEKPYQCDICNKCFS
RNNDLIKHKGIHDRKPT
Download sequence
Identical sequences A0A0L8H224
Ocbimv22024026m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]