SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22026474m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22026474m.p
Domain Number 1 Region: 1200-1328
Classification Level Classification E-value
Superfamily PH domain-like 9.81e-17
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22026474m.p
Sequence length 1348
Sequence
MDEETRKIIERTKERREKLKMMSETDGTHRRRRPLSEDMSANIETVQDDDSPKRQCLRSA
EQNIKPDTPAIRGVQSRRNDLTTLCLSSDDGDYVPVPVPRKSLCQEENRDPNQEVFKPQC
RSRLAKLAQRINAWDDDYSKHETVGLFSRPNSVHSVDRERDIPMTTAFTEVPLETRDSRS
RSAAPVAPHMRSPRSKSAAPIASAPATPVPVRSKSPGPSYAPRSPAPVAPRLMPSDDLET
AIETMSRQQKPLRNNKKIPYTAKGSGHDHLQDIPSGIPVNARGLNDSLTQGETTDDEPTN
KPVSERLAKWSKKVSATEINCASPSKSENTQPNSKTTTPMGNRCSQNLSSKVAQLEKSLG
ISSTPKQNRAAFSNQQSSQSSGSSSVQINSVSSSAPSSATHNTPAAEPINGKNKQGNKRR
ESFEPTSQSVSERMAEWQKKVNTLEAVTEKEPTAYPVNARMSAWEQVTASGSTESNKMIK
PKGTTLPCPTTTPSRPVSANIPTSACIPKSPGMARKFESPVVKSNSVDAKSKPLSPSKAS
CAMKAIQQRLFETQQSTTTQSLAERIRQERMAELKVLENRWHNGILKDNTVKSDQESDVN
EPSATVPNEKKTGQMVATSGIPPPPPPSLPALSKTTASATSSKTTTTASTGESSSIFKLV
AVPEKKSALVNSEDTPLKSVVKQVRFEDSFESSDDYYGYGHYQESSIDDISDETDAERTL
ESHQDLQYMEQDFEDDYYSSSEENEALCRAAAAQNNMSHPDNDESDDVSISAFVPESVRQ
QYKLSLQTESSTNIIELAKRQQHLEKSKNRKYQPHDNIDSTDDTLDEDYDSDEMESMATT
SVDDLIDDALDSDTDDNRLQTTPIQSANKRGSHLLATCTDSCYDDTTTDDDVVMRKRSPL
MYSISMYRSKRFSNNTTPVQKIVRNSRPMSSEEELEREKPKEDSRKSILERIKQLSNQVS
LEQTVILQTSNALNQCCTEGSNFSGSAQQVECHKLLLIACQKRRAYLEEIQRLKASNCLN
PFGPGTKGTLAISDIRLPLKKDFVSRMSTVYDLNVFYYVILIRNGPQVFTTQLISTHDPM
VRGSLDFPNMIKMTDITSKFQVTLELYEMCWCHKKYFKASNTLCKVVGVRHDIQLQKTCK
MKQTISSNPAGPTSIHSSSFTLTWSTSLKMSNIDKNSFTMDRVPYDAPLIGSIYLRMKCN
METNVSESGFLTMFEDVSGLGAWHRRWCALSGNKMKYWKYPDDENRKDPIGYIDLKRCIT
EKVGLISRDICARPNTFEMCTVRPLRPGEEDTLVTRKHHTMATIRHMLSADTKEERILWC
NKLNEALDNIRAWQVDALKPIKVPSHAV
Download sequence
Identical sequences A0A0L8GX63
Ocbimv22026474m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]