SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22028607m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22028607m.p
Domain Number 1 Region: 184-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 70-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.29e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 3 Region: 129-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 32-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22028607m.p
Sequence length 241
Sequence
MENEFCEEPIEIKTKSGRLDSPDEIQNEREERLYSCDICKKSFSQKSHLTDHKYVHTREK
SYHCDICGKSFSRSSSLITHKRIHTGDKPYHCDICGKSYSQIGHLNTHKCIHTGEKPYHC
DICGKSLTTSGMLTSHKRIHTGERPYHCDICGKSFSHRSSLSTHRSVHSGEKPYHCDICG
KSCSQSSDLIKHKRVHTGEKPYHCDICSKSFSDSSTLIHHKRVHTGEKPFHCDICGKSFS
K
Download sequence
Identical sequences A0A0L8I8H7
Ocbimv22028607m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]