SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22029728m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22029728m.p
Domain Number 1 Region: 270-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 242-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000429
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 3 Region: 312-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000279
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 212-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000637
Family Classic zinc finger, C2H2 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22029728m.p
Sequence length 355
Sequence
MEVTLELNCLDTNCHRVPQHVIAPVTKEKLSPCQPCVIDLPHSSHSPSTSPSQAPRQLDL
PGWPTQTLLPPHSLHHHPNPPGYVSTHCSIPTLPPITSPNDPHFPLHLYKQDTALYRRSH
FIPCLPIIPSAVHHHNSPCFSRLTPSPDRLFPESKRIDRYDFDAKLSQQHLDLLLMNMSP
TSSLEHSPRSIDSTVSVEKRKARNSSDSELTSRFVCEACNKSYSTLSGLSRHKQYHCSTQ
VKKEFNCKYCNKTYLSLGALKMHIRTHTLPCKCKVCGKAFSRPWLLQGHIRTHTGEKPFK
CTHCGRAFADRSNLRAHFQTHSDVKKYSCKACTKTFSRMSLLSKHEESSCHRLVR
Download sequence
Identical sequences A0A0L8GRN9
Ocbimv22029728m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]