SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22034986m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22034986m.p
Domain Number 1 Region: 70-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.62e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 127-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 34-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.64e-18
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 172-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.33e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22034986m.p
Sequence length 226
Sequence
MESEISENNVARKILAKSIVLPDDLKNEKGRTSFNCDVCGKSFSQNCKLTKHKSIHTGER
PYCCDICGKSFSQKGNLIIHKRIHTGEKPYPCHICGEAFSLKGNLITHQRIHTGEKPYVC
DICDKPFSQKHKLVTHQRIHTGEKPYHCDTCGESFSQSIHLTKHIRIHTGEKPYHCDICS
KSFSQSSSLTKHKATHTEEKPYHCDICTESFSQSAQLTKHIRIHTG
Download sequence
Identical sequences A0A0L8GE38
Ocbimv22034986m.p XP_014781812.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]