SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Ocbimv22034988m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22034988m.p
Domain Number 1 Region: 153-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 40-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 96-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 194-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22034988m.p
Sequence length 257
Sequence
MENELIENKVKSEIQKIDFSDDVKNEKGKPSFNCDICGKSFCRKGNITKHKLIHTGEKPY
HCDICGKSFYQSDHLTIHVRIHTGEKPYFCDFCGKSFSENSSLTKHKRIHTLEKPHNCDF
CGKSFSNGDGLTRHKRIHTGEKPHPCDICGKPFSQRGDLSRHKYIHAEEKPYHCDICGKS
FSQKGNLIKHKRIHTGEKPYHCDICGQSFCASCDLTIHIRIHTGEKPYHCDICGKSFSKK
ATLNSHKNIHTREKHLV
Download sequence
Identical sequences A0A0L8GEL7
XP_014781808.1.24776 XP_014781809.1.24776 XP_014781810.1.24776 XP_014781811.1.24776 Ocbimv22034988m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]