SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Ocbimv22035540m.p from Octopus bimaculoides 280

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Ocbimv22035540m.p
Domain Number 1 Region: 302-583
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-80
Family Kelch motif 0.00000000475
Further Details:      
 
Domain Number 2 Region: 35-153
Classification Level Classification E-value
Superfamily POZ domain 6.28e-37
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Ocbimv22035540m.p
Sequence length 589
Sequence
MAANTAIKGQIGMFQSCYRPKPVSSEKPSDGSMHFSIIRHPKELLDVMNILWHSRKLCDV
TFKVGEESFQAHKIVLAAASPYFRAMFTGGMKEEDMTEIPLHCISPCILGILINFAYTSE
IQINEMNVCQLLPAATMFQITRIVEACTVFLEQQLDPSNCIGIADFASEHGCMDLYSKAG
EYIYQNFCKVSKCEEFLMLSPCRLVSLIKHDELNVACESEVFNAVIRWVENDSEKRLSKL
ESLLGAVRCHFLSPKFLEKQLKMCKLLKKNPQCQNYLARIFEELKLHKQIPEVCRKPCKP
MVIFTAGGYLRQSLSNFEFFNLENNEWRRLPDLPVPRSGLSACVVKGILYVVGGRNNSPD
GNMDSASLDMYDPYRNMWRPCAQMSVPRNRVGVGTIDNMIYAIGGSHGSQHHEIAERYDP
EIDRWILISPMETKRIGVGVGIVNRLLYAVGGFDGRNRLCSVECYHPERDEWKFVASMNT
VRSGAGVIGMEHYIYAVGGYDSHSQLRSVERYCTETNVWEYVASMNSPRSALSVAVVGGK
LFALGGYDGNDFLSSVECYDPDTNCWTNVTNMTCGRSGHGVAVGAEPCS
Download sequence
Identical sequences A0A0L8GE93
Ocbimv22035540m.p XP_014782079.1.24776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]